Recombinant Kluyveromyces lactis 3-ketodihydrosphingosine reductase TSC10 (TSC10)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TSC10; KLLA0F01749g; 3-ketodihydrosphingosine reductase TSC10; 3-dehydrosphinganine reductase; KDS reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-313
Protein Length
full length protein
Species
Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)
Target Names
TSC10
Target Protein Sequence
MKGFNCNGQVILISGGSQGLGESFAKRFVQDDDGPGSNTNKVIIVSRSQSKLVKACERIG VDGVSLDRYVNDTNRNETKLIYHSCDTSSYDKVALMFKLLVKSELVPSQVYMCAGGSIPK LFLDLTPEELQNGITTNYSTAVNLAHVSLKHDVPHLLFFSSEVAFFPFIGYAQYAPLKQS IRSLVAILRQEHSSTRITCVYPGNFQSEGFDLENITKPAITKEIEGPSNPVTAAQCRDKI ISSLKWGLDDITTDSIGWLLMACDQGLNKHSTSQFMFVFSWILGALLNITIVPIYMLICK FQIYQWKRNKDTK
Uniprot No.

Target Background

Function
Catalyzes the reduction of 3-ketodihydrosphingosine (KDS) to dihydrosphingosine (DHS).
Database Links
Protein Families
Short-chain dehydrogenases/reductases (SDR) family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is 3-ketodihydrosphingosine reductase TSC10 and what is its function?

3-ketodihydrosphingosine reductase TSC10 (EC 1.1.1.102) is an enzyme that catalyzes the second step in de novo sphingolipid biosynthesis. It specifically reduces 3-ketodihydrosphingosine to produce dihydrosphingosine (sphinganine). The enzyme belongs to the short-chain dehydrogenase/reductase (SDR) superfamily and is known by alternative names including 3-dehydrosphinganine reductase and KDS reductase . This reaction is crucial for the biosynthesis of sphingolipids, which are essential components of eukaryotic cell membranes and involved in various cellular processes including signaling and stress response.

What structural features characterize TSC10 proteins?

TSC10 proteins adopt a Rossmann fold, which is characteristic of the SDR superfamily. Based on structural studies of TSC10 from other fungal species such as Cryptococcus neoformans, the enzyme features a central seven-stranded β-sheet flanked by α-helices on both sides . The protein contains a catalytic triad that includes serine and tyrosine residues, though certain regions around these residues may be disordered. In solution, TSC10 predominantly exists as a dimer, with a minor portion forming homo-tetramers . The dimer interface involves both hydrophobic and hydrophilic interactions mediated by specific helices and loop regions.

Why is Kluyveromyces lactis used as an expression system for recombinant proteins like TSC10?

K. lactis has emerged as an important non-Saccharomyces yeast for heterologous protein expression due to several advantages:

  • It has a history of safe use in the food industry, facilitating regulatory approval

  • As a Crabtree-negative yeast, it can achieve high cell densities without producing ethanol during growth on glucose

  • It demonstrates excellent protein secretion capabilities, which simplifies downstream purification processes

  • It can perform post-translational modifications similar to those in higher eukaryotes

  • Well-established genetic tools and expression systems are available for K. lactis

Since 1991, approximately 100 recombinant proteins have been successfully expressed in K. lactis, demonstrating its versatility as an expression host .

What are the critical considerations when designing expression constructs for recombinant K. lactis TSC10?

When designing expression constructs for K. lactis TSC10, researchers should consider:

  • Codon optimization: Though not explicitly mentioned in the search results for TSC10, codon optimization is generally important for heterologous protein expression in K. lactis.

  • Signal peptide selection: If secretion is desired, appropriate signal peptides compatible with K. lactis secretory machinery should be selected.

  • Promoter choice: Several promoters are available for K. lactis, with varying strengths and induction properties. Selection should be based on desired expression levels and regulatory control.

  • Tag placement: For the TSC10 protein specifically, tag placement requires careful consideration. Based on crystal structure data from other fungal TSC10 proteins, adding tags at the C-terminus might affect tetramerization, while N-terminal tags might impact substrate recognition or catalytic activity .

  • Expression region selection: For K. lactis TSC10, the recommended expression region encompasses amino acids 1-313 to include the full catalytic domain .

How do fungal TSC10 and mammalian KDSR differ, and what implications does this have for antifungal drug development?

Fungal TSC10 and mammalian KDSR (also known as FVT-1) perform analogous functions in sphingolipid biosynthesis but exhibit important structural differences. The crystal structure of Cryptococcus neoformans TSC10 reveals that residues forming hydrogen bonds and salt bridges in the dimer interface are not conserved between fungal TSC10 and mammalian KDSR proteins . This structural difference presents a potential opportunity for developing selective inhibitors.

A strategic approach might target:

  • The unique dimer interface of fungal TSC10, since dimerization appears important for enzyme function

  • Fungal-specific substrate binding pocket variations

  • Differences in catalytic site flexibility between fungal and mammalian enzymes

These differences make TSC10 a promising target for antifungal drug development with potentially limited toxicity to mammalian cells .

What analytical methods are recommended for assessing the enzymatic activity of recombinant K. lactis TSC10?

For assessing enzymatic activity of recombinant K. lactis TSC10, researchers should consider:

  • Spectrophotometric assays: Monitoring NADPH consumption at 340 nm during the reduction of 3-ketodihydrosphingosine.

  • HPLC or LC-MS/MS methods: For direct measurement of substrate depletion and product formation.

  • In vitro reconstitution systems: Where purified recombinant TSC10 is incubated with substrate and cofactor under defined conditions.

  • Analysis of kinetic parameters: Determination of Km, Vmax, and catalytic efficiency (kcat/Km) with respect to both substrate and cofactor.

When designing such assays, researchers should account for the enzyme's dependence on NADPH as a cofactor and consider optimal buffer conditions, pH, and temperature for K. lactis TSC10 specifically.

What purification strategies are most effective for recombinant K. lactis TSC10?

Based on the information about TSC10 proteins and general knowledge of K. lactis protein purification:

  • Affinity chromatography: His-tagged TSC10 can be purified using nickel or cobalt affinity resins . The tag type should be determined during the production process to optimize purification efficiency.

  • Size exclusion chromatography: Since TSC10 exists in both dimeric and tetrameric forms, size exclusion chromatography can be used to separate these different oligomeric states for structural or functional studies .

  • Ion exchange chromatography: Given the charged nature of proteins, this method can provide additional purification steps.

  • Storage conditions: Purified TSC10 should be stored in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage . Avoiding repeated freeze-thaw cycles is recommended.

A table summarizing recommended purification protocols:

Purification StepMethodBuffer ConditionsNotes
Initial CaptureAffinity ChromatographyAccording to tag typeHis-tag is commonly used
Intermediate PurificationIon Exchange20-50 mM Tris or phosphate, pH 7-8Salt gradient elution
PolishingSize Exclusion20-50 mM Tris, 100-150 mM NaCl, pH 7.5Separates dimers from tetramers
Storage-Tris-based buffer, 50% glycerolStore at -20°C or -80°C

How can researchers assess the structural integrity and folding of recombinant K. lactis TSC10?

Several complementary methods can be employed to assess the structural integrity of recombinant K. lactis TSC10:

  • Circular dichroism (CD) spectroscopy: To evaluate secondary structure content and thermal stability.

  • Fluorescence spectroscopy: Intrinsic tryptophan fluorescence can provide information about tertiary structure.

  • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS): To determine oligomeric state distribution (dimer vs. tetramer) and potential aggregation .

  • Differential scanning fluorimetry (DSF): To assess thermal stability and potential ligand binding.

  • Limited proteolysis: To probe the accessibility of protease cleavage sites as an indicator of proper folding.

  • NADPH binding assays: Since TSC10 binds NADPH as a cofactor, NADPH binding can be used as a surrogate marker for correct folding.

By combining these approaches, researchers can comprehensively evaluate whether recombinant K. lactis TSC10 is properly folded and functionally active.

What insights can be gained from structural comparison of K. lactis TSC10 with homologs from other species?

Structural comparison between K. lactis TSC10 and homologs from other species can provide valuable insights:

  • Conservation of the Rossmann fold: Like the C. neoformans TSC10, K. lactis TSC10 is expected to adopt a Rossmann fold with a central seven-stranded β-sheet flanked by α-helices . Comparative analysis can reveal specific structural adaptations in K. lactis.

  • Dimer interface analysis: The dimer interface in C. neoformans TSC10 involves both hydrophobic and hydrophilic interactions mediated by helices α4 and α5, as well as the loop connecting strand β4 and helix α4 . Comparing these regions in K. lactis TSC10 could reveal species-specific interaction patterns.

  • Catalytic site organization: The catalytic triad in TSC10 proteins includes conserved serine and tyrosine residues. Structural comparison can help identify subtle differences in the organization of these residues that might influence substrate specificity or catalytic efficiency.

  • Substrate binding pocket: Comparing the substrate binding pockets across species can provide insights into substrate specificity and potential for rational enzyme engineering.

  • NADPH binding site: Analysis of the NADPH binding site across different species can reveal conservation patterns and potential differences in cofactor binding.

What is known about the catalytic mechanism of TSC10, and how might it be studied in the K. lactis enzyme?

Based on its classification as a short-chain dehydrogenase/reductase (SDR), TSC10 likely follows the general catalytic mechanism of this enzyme family:

  • Proposed catalytic mechanism: The reaction likely involves the transfer of a hydride from NADPH to the keto group of 3-ketodihydrosphingosine, with the conserved tyrosine residue acting as a proton donor.

  • Role of the catalytic triad: The catalytic triad typically consists of conserved serine, tyrosine, and lysine residues, with the tyrosine serving as the active site base.

  • Substrate binding: The substrate 3-ketodihydrosphingosine likely binds in a pocket adjacent to the NADPH binding site, positioning the keto group for hydride transfer.

To study this mechanism in K. lactis TSC10 specifically, researchers might:

  • Perform site-directed mutagenesis of predicted catalytic residues

  • Conduct kinetic analysis with substrate analogs

  • Use X-ray crystallography to capture enzyme-substrate complexes

  • Employ computational approaches like molecular dynamics simulations

  • Utilize isotope effects to probe transition states

How does K. lactis TSC10 compare with TSC10 from other yeast species in terms of enzymatic properties?

While specific comparative data for K. lactis TSC10 is not provided in the search results, researchers might investigate:

  • Substrate specificity: Whether K. lactis TSC10 has broader or narrower substrate tolerance compared to TSC10 from other yeasts like S. cerevisiae or C. neoformans .

  • Kinetic parameters: Comparing Km, kcat, and catalytic efficiency across species.

  • Oligomerization state: While C. neoformans TSC10 is predominantly dimeric with a minor tetrameric population , the oligomeric state preference might vary across species.

  • Temperature and pH optima: These parameters could reflect adaptation to different cellular environments.

  • Cofactor preference: While NADPH is the expected cofactor, subtle differences in binding affinity might exist.

A comparative study would provide insight into evolutionary adaptations of this enzyme across fungal lineages and might inform biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.