Recombinant Kluyveromyces lactis Altered inheritance of mitochondria protein 11 (AIM11)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to sediment the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
AIM11; KLLA0E20153g; Altered inheritance of mitochondria protein 11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-150
Protein Length
full length protein
Species
Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)
Target Names
AIM11
Target Protein Sequence
MSEVASVTDAQIEKFSLLYKERRKVQMMRFFGVTALTLISARLAFKGVASRKYIPTMFQL NHKPPPFSYKGEVVNALAYGTALSTGGFAMLGFGLCWIWDVSTLKELGNKLKELMGDGSE KDKLVSTNMDLDEDTQKVADALEAMLSTKK
Uniprot No.

Target Background

Database Links
Protein Families
AIM11 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the functional role of AIM11 in Kluyveromyces lactis mitochondria?

    AIM11 is primarily associated with mitochondrial genome maintenance in K. lactis. While the precise molecular mechanism remains under investigation, null mutants of AIM11 are viable but demonstrate increased loss of mitochondrial DNA and show synthetic interactions with prohibitin (phb1) . This suggests AIM11 plays a role in the stability of the mitochondrial genome, which is critical in K. lactis as this yeast is petite-negative (cannot tolerate loss of mitochondrial DNA) . The protein likely contributes to the mitochondrial inheritance pathway, ensuring proper distribution of mitochondria during cell division.

  • How does the mitochondrial inheritance system in K. lactis differ from other yeasts?

    K. lactis has distinct mitochondrial inheritance mechanisms compared to the well-studied Saccharomyces cerevisiae. While S. cerevisiae can survive without mitochondrial DNA (petite-positive), K. lactis cannot tolerate loss of mitochondrial DNA or mitochondrial protein synthesis (petite-negative) .

    Additionally, while S. cerevisiae has duplicated genes (resulting from whole-genome duplication) that form specialized aerobic/hypoxic pairs responding to oxygen availability, K. lactis typically has single orthologs of these genes that must function across varying oxygen conditions . This makes the mitochondrial inheritance and maintenance systems particularly crucial in K. lactis, as they cannot be compensated for by fermentation alone.

  • What are the optimal storage and reconstitution conditions for recombinant K. lactis AIM11 protein?

    For optimal stability and activity of recombinant K. lactis AIM11 protein, the following methodological approaches are recommended:

    • Store lyophilized powder at -20°C/-80°C upon receipt

    • Aliquot to avoid repeated freeze-thaw cycles, which significantly reduce protein activity

    • Working aliquots can be stored at 4°C for up to one week

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (optimally 50%) for long-term storage

    • After reconstitution, store at -20°C/-80°C in single-use aliquots

    • Briefly centrifuge vials prior to opening to bring contents to the bottom

Advanced Research Questions

  • How can researchers design experiments to study the role of AIM11 in mitochondrial inheritance pathways?

    When designing experiments to investigate AIM11's role in mitochondrial inheritance, researchers should consider:

    Experimental Design Table:

    ApproachIndependent VariablesDependent VariablesControlsKey Measurements
    Gene DeletionWild-type vs. AIM11Δ strainsMitochondrial genome stabilityComplementation with AIM11mtDNA copy number, mitochondrial membrane potential
    Protein LocalizationGrowth conditions (aerobic vs. hypoxic)AIM11 localizationFixed mitochondrial markersCo-localization coefficients
    Synthetic Genetic ArrayAIM11Δ combined with other deletionsGrowth rate, mitochondrial phenotypesSingle deletion strainsColony size, growth curves
    Protein-Protein InteractionAIM11 bait, mitochondrial proteomeBinding partnersTagged control proteinsAffinity purification-mass spectrometry results

    The experimental design should include proper controls and multiple biological replicates (n≥3) for statistical validation. For mitochondrial inheritance studies, fluorescent labeling of mitochondria using mtGFP constructs combined with time-lapse microscopy provides robust visualization of inheritance dynamics during cell division .

  • What are the current hypotheses about AIM11's molecular mechanism in relation to other mitochondrial inheritance proteins?

    Several hypotheses currently exist regarding AIM11's molecular mechanism:

    1. Actin-dependent transport hypothesis: AIM11 may function similarly to other inheritance factors like Mmr1p or Ypt11p in facilitating the interaction between mitochondria and the actin cytoskeleton, which is critical for proper mitochondrial inheritance during cell division .

    2. Membrane potential maintenance hypothesis: Based on studies of mitochondrial inheritance in K. lactis, AIM11 could be involved in maintaining the transmembrane potential (ΔΨ) across the mitochondrial inner membrane, which is essential for K. lactis viability .

    3. Mitochondrial genome stabilization hypothesis: Given that null mutants show increased loss of mitochondrial genome, AIM11 may function in the machinery that ensures proper replication, repair, or segregation of mtDNA during cell division .

    4. Prohibitin interaction hypothesis: The synthetic interaction with prohibitin (phb1) suggests AIM11 might function in a parallel pathway to the prohibitin complex, which regulates mitochondrial dynamics and membrane protein degradation .

    Recent research techniques including CRISPR/Cas9-mediated genome editing of mitochondrial DNA and fluorescent protein tagging are being employed to further elucidate these mechanisms .

  • How does the oxygen response system in K. lactis impact AIM11 function, and how does this differ from S. cerevisiae?

    The oxygen response system in K. lactis significantly differs from S. cerevisiae and likely impacts AIM11 function in several ways:

    1. K. lactis lacks the specialized gene duplication system present in S. cerevisiae where many genes exist as aerobic/hypoxic pairs (like COX5a/COX5b and CYC1/CYC7) .

    2. Instead of duplicated genes with specialized functions, K. lactis typically has single orthologs that must function across varying oxygen conditions. This suggests AIM11 must operate effectively across a range of oxygen levels rather than having specialized paralogs for different conditions .

    3. K. lactis cannot grow under strictly anoxic conditions but can adapt to hypoxic environments (oxygen below 1% of aerobic levels). This means AIM11 must function in a system that maintains mitochondrial integrity even during oxygen limitation .

    4. The ROX1 transcription factor, a major oxygen-responding regulator in S. cerevisiae, has different structural features and molecular functions in K. lactis, suggesting divergent regulatory mechanisms for mitochondrial proteins including potentially AIM11 .

    5. While S. cerevisiae can shift to fermentative metabolism under low oxygen, K. lactis relies more heavily on respiratory metabolism. This places greater importance on proteins like AIM11 that maintain mitochondrial function and inheritance .

  • What advanced analytical techniques are most effective for studying K. lactis AIM11 protein interactions and function?

    For comprehensive analysis of K. lactis AIM11 protein interactions and function, researchers should consider these advanced analytical techniques:

    1. Proximity-based labeling (BioID or APEX) to identify proteins in close proximity to AIM11 within the mitochondrial environment

    2. Quantitative proteomics using SILAC or TMT labeling to compare mitochondrial proteome changes between wild-type and AIM11Δ strains

    3. Cryo-electron microscopy to visualize AIM11's structural integration within mitochondrial membranes

    4. Fluorescence Recovery After Photobleaching (FRAP) to measure AIM11 mobility and dynamics within mitochondrial membranes

    5. Live-cell super-resolution microscopy techniques like PALM or STORM to visualize AIM11 distribution during mitochondrial inheritance with nanometer precision

    6. Mitochondrial genome sequencing to assess mtDNA stability and potential mutation patterns in AIM11Δ strains

    7. Respirometry assays (such as Seahorse XF analysis) to measure functional impacts on mitochondrial respiration in AIM11 mutants

    8. Chromatin immunoprecipitation followed by sequencing (ChIP-seq) if AIM11 has potential interactions with mitochondrial nucleoids

  • What are the comparative differences in mitochondrial genome maintenance between AIM11 in K. lactis and related proteins in other yeast species?

    The mitochondrial genome maintenance systems show significant species-specific adaptations:

    SpeciesMitochondrial GenomePetite PhenotypeKey Maintenance FactorsAIM11 Homolog Function
    K. lactis40,291 bp circular, 26.1% GC contentPetite-negative (cannot survive mtDNA loss)AIM11, MGI genesCritical for mtDNA stability
    S. cerevisiae~85,800 bp circular, highly variablePetite-positive (can survive mtDNA loss)Various duplicated genes post-WGDLess critical due to metabolic flexibility
    C. albicans~40,420 bp circularPetite-negativeSpecies-specific factorsNot well characterized

    Several key differences distinguish K. lactis AIM11 from related systems:

    1. The K. lactis mitochondrial genome is approximately half the size of S. cerevisiae's, with reduced intergenic and intronic sequences but equivalent coding capacity

    2. K. lactis cannot tolerate rho⁰ mutations (complete loss of mtDNA), making proteins like AIM11 that maintain mitochondrial genome integrity especially critical

    3. Unlike S. cerevisiae, which underwent whole-genome duplication (WGD), K. lactis has singular copies of mitochondrial inheritance genes, suggesting less functional redundancy and potentially more essential roles for proteins like AIM11

    4. Specific mutations in the ATP synthase β-subunit (atp2.1) can suppress rho⁰-lethality in K. lactis, suggesting complex interactions between electron transport, ATP production, and mitochondrial genome maintenance pathways that may involve AIM11

  • What experimental approaches should be used to evaluate whether recombinant K. lactis AIM11 protein is properly folded and functional?

    Evaluating proper folding and function of recombinant K. lactis AIM11 requires multiple complementary approaches:

    1. Circular dichroism (CD) spectroscopy to assess secondary structure elements and compare with computational predictions

    2. Thermal shift assays to determine protein stability and proper folding through melting temperature analysis

    3. Size exclusion chromatography with multi-angle light scattering (SEC-MALS) to verify monodispersity and proper oligomeric state

    4. Functional complementation assays in AIM11Δ yeast strains to assess biological activity:

      • Transform AIM11Δ mutants with the recombinant protein

      • Measure rescue of mitochondrial inheritance defects

      • Quantify mitochondrial DNA stability restoration

    5. Limited proteolysis coupled with mass spectrometry to confirm proper domain folding

    6. Binding assays with potential interaction partners identified through previous studies

    7. In vitro activity assays based on hypothesized biochemical functions

    When conducting these analyses, researchers should compare multiple batches of protein and establish quality control benchmarks for specific applications .

  • How can CRISPR/Cas9 technology be adapted for studying AIM11 function in mitochondrial inheritance in K. lactis?

    Adapting CRISPR/Cas9 technology for studying AIM11 in K. lactis mitochondria requires specialized approaches:

    1. Mitochondrial-targeted CRISPR/Cas9 system:

      • Engineer Cas9 with mitochondrial localization signals (MLS)

      • Design hybrid sgRNAs with RNA import elements (such as the RNase P RNA stem-loop structure) to facilitate mitochondrial import

      • Confirm mitochondrial localization using fluorescently-tagged constructs

    2. Genome editing strategies:

      • For nuclear-encoded AIM11: Standard CRISPR/Cas9 with appropriate K. lactis promoters and terminators

      • For studying AIM11's effect on mtDNA: Mitochondrial-targeted CRISPR system to introduce specific mtDNA modifications

    3. Verification methods:

      • PCR and sequencing to confirm nuclear edits

      • Quantitative PCR to measure heteroplasmy levels in mitochondrial edits

      • Western blotting to verify protein expression changes

      • Microscopy with mtGFP to visualize mitochondrial morphology and inheritance

    4. Advanced applications:

      • CRISPR interference (CRISPRi) with deactivated Cas9 for transient knockdown

      • CRISPR activation (CRISPRa) to upregulate AIM11 expression

      • Base editors for introducing specific point mutations

    Recent studies have demonstrated the feasibility of mitochondrial-targeted CRISPR systems, showing that hybrid sgRNAs with RNA import elements can be transported into mitochondria through PNPase-dependent pathways, allowing for targeted modification of mitochondrial genes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.