Recombinant Kluyveromyces lactis Altered inheritance of mitochondria protein 31, mitochondrial (AIM31)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for prioritized development.
Synonyms
RCF1; AIM31; KLLA0B01672g; Respiratory supercomplex factor 1, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-158
Protein Length
full length protein
Species
Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)
Target Names
RCF1
Target Protein Sequence
MSYLPSSFDSDADDLDEMPFLDKMIYHCKQQPLVPLGTLATTGAVLLAVLNVKNGNKRKA QIWFRWRVALQGFTLIALVAGSYIYGTNKNERESHEEQLRKKAKMREQLWIQELERRDEE TKLRRQKAELARQKAKEMEQETSKLQQELKDLEERLKK
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit involved in the assembly of respiratory supercomplexes.

Database Links
Protein Families
RCF1 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

How does AIM31/RCF1 function differ between K. lactis and other yeast species?

  • In K. lactis, which is predominantly respiratory rather than fermentative (unlike S. cerevisiae), mitochondrial proteins like AIM31 potentially play more essential roles in cellular metabolism and energy production .

  • K. lactis is naturally "petite-negative" (unable to grow without functional mitochondrial DNA), suggesting that proteins involved in mitochondrial integrity like AIM31 may have distinctive functions compared to their S. cerevisiae counterparts .

  • The hypoxic response in K. lactis differs notably from S. cerevisiae, which may influence how mitochondrial proteins like AIM31 function under oxygen-limited conditions .

These differences are particularly significant when designing experiments to investigate mitochondrial protein function across different yeast species.

What experimental design principles should researchers follow when investigating AIM31 function in K. lactis?

When designing experiments to study AIM31 function in K. lactis, researchers should consider the following approach:

Table 1: Experimental Design Framework for AIM31 Functional Studies

ComponentConsiderationsImplementation
HypothesisClear, testable hypothesis about AIM31 functionExample: "AIM31 is essential for respiratory growth in K. lactis under hypoxic conditions"
Independent VariableFactor being manipulatedAIM31 expression levels (wild-type, knockout, overexpression)
Dependent VariableMeasurable outcomeRespiratory capacity, mitochondrial integrity, growth rate
Control GroupsReference conditionsWild-type K. lactis strain, empty vector controls
Controlled VariablesFactors kept constantTemperature, media composition, oxygen levels
Number of TrialsStatistical robustnessMinimum 3 biological replicates with 3 technical replicates each
Data CollectionQuantifiable measurementsGrowth curves, oxygen consumption rates, mtDNA stability assays

Researchers should place particular emphasis on environmental conditions, as these significantly impact mitochondrial inheritance and function in yeast systems . The experimental design should include appropriate controls and be structured to isolate the specific effects of AIM31 alteration from other factors affecting mitochondrial function.

What gene modification approaches are most effective for studying AIM31 in K. lactis?

For genetic manipulation of AIM31 in K. lactis, several approaches have proven effective:

  • Targeted gene disruption: This can be achieved using homologous recombination, similar to the approach used for CYC1 gene disruption in K. lactis as described in search result . For AIM31, researchers can design disruption cassettes with selectable markers flanked by sequences homologous to the AIM31 locus.

  • Expression system using pKLAC vectors: The K. lactis Protein Expression Kit containing pKLAC vectors allows for controlled expression of AIM31 variants . This system incorporates:

    • The LAC4 promoter for galactose/lactose-inducible expression

    • Integration of the expression cassette into the K. lactis genome at the LAC4 locus

    • Selection using the acetamidase gene (amdS) on nitrogen-free media containing acetamide

  • Autoselection system: For long-term stability of plasmids expressing AIM31 variants, an autoselection system based on pyrimidine pathway blockage can be employed. This system maintains plasmid retention above 90% after 70 generations, compared to only 4% retention in non-autoselection strains .

The choice of method depends on the specific research question, with genome integration approaches being more stable for long-term phenotypic analyses and plasmid-based systems offering more flexibility for expressing multiple variants.

How might AIM31 contribute to mitochondrial inheritance mechanisms in K. lactis?

While the specific role of AIM31 in mitochondrial inheritance requires further investigation, several mechanistic possibilities exist based on current understanding of mitochondrial inheritance factors:

  • Potential role in mitochondrial membrane dynamics: The sequence characteristics of AIM31 suggest it may be involved in mitochondrial membrane organization . Similar proteins in other organisms participate in mitochondrial segregation during cell division.

  • Interaction with MGI pathways: K. lactis MGI (Mitochondrial Genome Integrity) genes, when mutated, convert K. lactis into a petite-positive yeast that can lose mitochondrial DNA . AIM31 may function within this pathway to maintain mitochondrial genome stability.

  • Possible involvement in respiratory chain supercomplex formation: As AIM31 is also known as Respiratory supercomplex factor 1 (RCF1) , it may participate in organizing respiratory chain components, which indirectly influences mitochondrial inheritance by affecting organelle fitness.

  • Environmental response regulation: Environmental factors influence mitochondrial inheritance in yeasts . AIM31 might serve as a sensor or effector in pathways that regulate mitochondrial inheritance in response to environmental changes.

What techniques are most informative for analyzing AIM31's role in mitochondrial dynamics?

To comprehensively analyze AIM31's role in mitochondrial dynamics, researchers should employ multiple complementary techniques:

  • Live-cell imaging: Using fluorescently tagged mitochondrial markers to visualize mitochondrial inheritance and dynamics in AIM31 wild-type versus mutant cells.

  • Biochemical interaction studies: Co-immunoprecipitation or proximity labeling approaches to identify AIM31 interaction partners within the mitochondrial network.

  • Respiration analysis: Measuring oxygen consumption rates and respiratory capacity in cells with altered AIM31 expression.

  • mtDNA stability assays: Quantifying mitochondrial DNA levels and integrity over time in cells with normal versus altered AIM31 function, especially under stress conditions.

  • Proteomics analysis: Comparing the mitochondrial proteome in wild-type versus AIM31-altered strains to identify broader impacts on mitochondrial composition.

For analyzing potential roles in mitochondrial inheritance specifically, researchers can adapt methods from studies on other mitochondrial inheritance determinants, such as those used to study SAMM50 and other factors .

What are the optimal conditions for expressing and purifying recombinant K. lactis AIM31?

Based on established protocols for mitochondrial proteins, the following optimized procedure is recommended for AIM31:

Expression System Selection:
The K. lactis GG799 strain is recommended for expression of recombinant AIM31, as it supports high cell density growth and efficient protein expression . This strain, combined with pKLAC-based vectors, provides a robust expression platform .

Expression Protocol:

  • Clone the AIM31 gene into pKLAC2 vector downstream of the α-mating factor secretion signal if secretion is desired, or without the signal for intracellular expression .

  • Linearize the construct with SacII or BstXI to produce an expression cassette for genomic integration.

  • Transform competent K. lactis GG799 cells using the NEB Yeast Transformation Reagent.

  • Select transformants on nitrogen-free minimal medium containing acetamide.

  • Culture in yeast/peptone/glucose medium for optimal yield.

Purification Strategy:
For His-tagged AIM31 protein (as described in search result ):

  • Lyse cells in Tris-based buffer with protease inhibitors.

  • Purify using nickel affinity chromatography.

  • Elute in Tris/PBS-based buffer with 6% trehalose at pH 8.0.

  • Store the purified protein at -20°C/-80°C in storage buffer containing 50% glycerol to maintain stability .

Critical Parameters:

  • Avoid repeated freeze-thaw cycles, which significantly reduce protein stability.

  • Maintain working aliquots at 4°C for up to one week only.

  • Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol for long-term storage .

How can researchers validate the functional integrity of purified recombinant AIM31?

Validating functional integrity of purified AIM31 requires multiple approaches:

  • Structural integrity validation:

    • SDS-PAGE analysis to confirm protein purity (>90% is considered acceptable)

    • Circular dichroism spectroscopy to verify proper secondary structure formation

    • Limited proteolysis to assess folding quality

  • Membrane association assays:

    • Liposome binding assays to confirm the protein's ability to associate with membrane-like structures

    • Detergent solubility profiles to assess membrane protein characteristics

  • Functional validation:

    • In vitro reconstitution with isolated mitochondrial fractions

    • Protein-protein interaction assays with known mitochondrial complex components

    • When possible, complementation assays in AIM31-deficient yeast strains

  • Activity measurements:

    • If specific enzymatic activity is known, develop appropriate biochemical assays

    • For respiratory complex association, measure impact on electron transport efficiency

Robust validation requires combining these approaches to ensure both structural and functional integrity of the purified protein.

How should researchers analyze data from AIM31 functional studies to avoid misinterpretation?

When analyzing data from AIM31 functional studies, researchers should implement the following practices to ensure robust interpretation:

  • Statistical rigor:

    • Apply appropriate statistical tests based on data distribution

    • Use multiple biological and technical replicates (minimum n=3)

    • Report effect sizes along with p-values

    • Consider Bayesian approaches for complex datasets

  • Control comparisons:

    • Always include both positive and negative controls

    • Compare results to wild-type K. lactis and to strains with known mitochondrial defects

    • Include empty vector controls for expression studies

  • Environmental variable consideration:

    • Given that environmental factors influence mitochondrial inheritance , analyze data across multiple growth conditions

    • Document and control for oxygen levels, temperature, and medium composition

  • Data presentation:

    • Present raw data alongside normalized results

    • Use appropriate scaling and visualization techniques

    • For time-course experiments, show entire curves rather than selected timepoints

  • Integrated analysis:

    • Combine multiple measurement approaches (e.g., growth, respiration, protein levels)

    • Use correlation analyses to identify relationships between different parameters

    • Consider principal component analysis for complex datasets

What are common technical challenges when studying AIM31 and how can they be addressed?

Researchers frequently encounter several challenges when studying mitochondrial proteins like AIM31:

Table 2: Common Challenges and Solutions in AIM31 Research

ChallengePotential CausesSolutions
Low expression yieldsProtein toxicity, poor codon optimizationOptimize codon usage for K. lactis, use inducible promoters with tight regulation, test different growth conditions
Protein insolubilityHydrophobic transmembrane regions, improper foldingUse mild detergents (0.1% Triton X-100, DDM), optimize lysis conditions, consider fusion tags that enhance solubility
Inconsistent phenotypes in mutant strainsGenetic background effects, suppressor mutationsGenerate multiple independent mutants, perform whole genome sequencing to identify suppressors, backcross to parental strain
Mitochondrial assay variabilityFluctuations in mitochondrial content, uncontrolled growth conditionsNormalize to mitochondrial markers, standardize growth phase for analysis, increase biological replicates
Difficulty in detecting protein-protein interactionsTransient interactions, membrane environment disruptionUse crosslinking approaches, membrane-compatible co-IP methods, proximity labeling techniques
Poor antibody specificityHigh conservation between homologous proteinsGenerate peptide-specific antibodies, use epitope tagging, validate specificity with knockout controls

When troubleshooting these issues, a systematic approach is essential. Begin by validating reagents and protocols with appropriate controls, then systematically modify individual parameters while maintaining others constant to identify the specific factor causing difficulties.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.