Recombinant Kluyveromyces lactis Altered inheritance of mitochondria protein 34, mitochondrial (AIM34)

Shipped with Ice Packs
In Stock

Description

General Information

Kluyveromyces lactis is a yeast species that has become a focus for genetic analysis and recombinant protein expression . Kluyveromyces lactis Altered Inheritance of Mitochondria protein 34, mitochondrial (AIM34) is a protein associated with mitochondrial function . AIM34 is also identified as KLLA0C06072g .

Protein Information

Recombinant Kluyveromyces lactis AIM34 is produced in E. coli with a His-tag fused to the N-terminal . The full-length mature protein consists of amino acids 45-253 . The protein's amino acid sequence is :

HSPMLSSDSHASFTRMSLKTLKNECRTRGLKVSGKKTELVERILLFEGSSSKKLHTSAIQRAKNDSSHIDSMKIPNVAKLEAEAESRKTDYIVKVPSIVNNAATEPKTKIEKDYEKKLQPADKKPLAENVGTVATPDADNVIQTPSVSDSIKVVNPEEELRSGSSEQGRSYSQQDEELTSRDKKFLLGFAGTVAAWWSLRFWKKEESKK

The recombinant protein's molecular weight and purity are determined through SDS-PAGE, with a purity level greater than 90% . It is typically stored in a Tris/PBS-based buffer with 6% Trehalose at a pH of 8.0 .

Gene Information

Gene NameAIM34
SynonymsAIM34; KLLA0C06072g; Altered inheritance of mitochondria protein 34, mitochondrial
UniProt IDQ6CUC1

Function and Pathways

AIM34 is involved in several pathways and biochemical functions . These functions may be performed in cooperation with other proteins .

Interactions

AIM34 interacts directly with other proteins and molecules, as detected through methods such as yeast two-hybrid assays, co-IP, and pull-down assays .

Product Specs

Form
Supplied as a lyophilized powder.

Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for guaranteed fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.

Note: Our proteins are shipped standard with blue ice packs. Dry ice shipping is available upon request and incurs an additional fee. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

Note: While the tag type is determined during production, please inform us of any specific tag requirements for preferential development.
Synonyms
AIM34; KLLA0C06072g; Altered inheritance of mitochondria protein 34, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
45-253
Protein Length
Full Length of Mature Protein
Species
Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)
Target Names
AIM34
Target Protein Sequence
HSPMLSSDSHASFTRMSLKTLKNECRTRGLKVSGKKTELVERILLFEGSSSKKLHTSAIQ RAKNDSSHIDSMKIPNVAKLEAEAESRKTDYIVKVPSIVNNAATEPKTKIEKDYEKKLQP ADKKPLAENVGTVATPDADNVIQTPSVSDSIKVVNPEEELRSGSSEQGRSYSQQDEELTS RDKKFLLGFAGTVAAWWSLRFWKKEESKK
Uniprot No.

Target Background

Database Links
Protein Families
AIM34 family
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein.

Q&A

Why is Kluyveromyces lactis an advantageous model organism for studying mitochondrial proteins compared to Saccharomyces cerevisiae?

Kluyveromyces lactis offers several distinct advantages for studying mitochondrial proteins like AIM34:

  • Metabolic profile: K. lactis exhibits a predominantly respiratory metabolism, in contrast to S. cerevisiae's predominantly fermentative metabolism . This makes K. lactis more representative of oxidative metabolism found in human tissues such as neural networks.

  • Genetic diversity: K. lactis displays remarkably high genetic diversity (π = 2.8 × 10^-2), almost 10-fold higher than S. cerevisiae (π = 3 × 10^-3) and more than twice that of its close relative K. marxianus (π = 1.2 × 10^-2) . This diversity facilitates comparative genetic studies.

  • Mitochondrial genome: K. lactis possesses a 40.3 kb mitochondrial genome containing the same set of eight protein-coding genes as S. cerevisiae: three ATP synthase complex subunits (ATP6, ATP8, ATP9), apocytochrome b (CYTB), three cytochrome c oxidase complex subunits (COX1, COX2, COX3), and a ribosomal protein (VAR1) .

These characteristics make K. lactis particularly suitable for studying mitochondrial proteins and processes, providing insights that may be more translatable to human cellular systems than those derived from S. cerevisiae models.

What are the optimal expression and purification methods for obtaining functional recombinant AIM34?

The recommended protocol for expression and purification of recombinant AIM34 involves the following methodology:

Expression System:

  • Host: E. coli (typically BL21-DE3 or similar expression strains)

  • Vector: Expression vectors containing an N-terminal His-tag fusion

  • Target: Full-length mature protein (amino acids 45-253)

Purification Strategy:

  • Affinity chromatography: Utilize the N-terminal His-tag for metal affinity purification

  • Quality control: Verify purity via SDS-PAGE (>90% purity expected)

  • Formulation: Lyophilize in Tris/PBS-based buffer with 6% Trehalose, pH 8.0

Reconstitution Protocol:

  • Briefly centrifuge the vial before opening to collect material

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • For long-term storage, add glycerol to a final concentration of 5-50% (typically 50%)

  • Aliquot to prevent repeated freeze-thaw cycles

This methodology consistently yields pure, functional recombinant AIM34 suitable for downstream applications in mitochondrial research.

What genome editing techniques can be employed to study AIM34 function in Kluyveromyces lactis?

Recent advances have established effective genome editing protocols for K. lactis that can be applied to study AIM34 function:

CRISPR/Cas9 System:

A wide-host-range CRISPR/Cas9 system has been developed for Kluyveromyces yeasts, demonstrating high targeting efficiency (≥96%) and homologous repair in at least 24% of transformants . This system involves:

  • Vector delivery: Plasmid-borne expression of Cas9 and guide RNA

  • Target selection: Design of specific gRNAs targeting the AIM34 locus

  • Selection: Hygromycin B selection at 200 μg/mL for Kluyveromyces species

  • Verification: PCR-based confirmation of genomic modifications

Traditional Homologous Recombination:

For targeted integration approaches:

  • Vector construction: Create a linearized expression vector containing AIM34 variants

  • Integration targeting: Direct integration to the LAC4 chromosomal locus promoter region

  • Selection strategies:

    • Antibiotic resistance (neomycin, hygromycin B)

    • Auxotrophic markers (ura3, his3, trp1)

    • Acetamide selection using the Aspergillus acetamidase (amdS) gene

Notably, acetamide selection enriches for strains with multiple tandem-vector integrations, potentially increasing expression levels compared to antibiotic selection methods . These techniques allow for precise genetic manipulation of AIM34 to investigate its functional roles through knockout, knockdown, or targeted mutations.

How should researchers store and handle recombinant AIM34 to maintain optimal activity?

Proper storage and handling of recombinant AIM34 is critical for maintaining its functional integrity. The following protocol is recommended based on manufacturer specifications:

ParameterRecommendation
Storage temperature-20°C/-80°C upon receipt
Working aliquotsStore at 4°C for up to one week
Freeze-thaw cyclesAvoid repeated cycles (aliquoting necessary)
Storage bufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Alternative bufferTris-based buffer, 50% glycerol
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mL
Long-term preservationAdd 5-50% glycerol (typically 50%)
Physical stateLyophilized powder as supplied

Prior to reconstitution, it is recommended to briefly centrifuge the vial to bring contents to the bottom . These storage conditions maintain protein stability and prevent activity loss from degradation or aggregation.

What experimental approaches can be used to investigate AIM34's role in mitochondrial inheritance?

While specific methodologies for AIM34 are not explicitly described in the search results, several approaches can be adapted for investigating its role in mitochondrial inheritance:

Genetic Approaches:

  • Gene knockout/knockdown: Generate AIM34-deficient strains using CRISPR/Cas9 or homologous recombination techniques

  • Complementation assays: Express wild-type or mutated AIM34 in knockout strains to identify functional domains

  • Fluorescent tagging: Create C- or N-terminal fluorescent protein fusions to track AIM34 localization and dynamics

Biochemical Approaches:

  • Protein-protein interaction studies:

    • Co-immunoprecipitation using His-tagged recombinant AIM34

    • Yeast two-hybrid screening

    • Proximity labeling (BioID, APEX)

    • Crosslinking mass spectrometry

  • Functional assays:

    • Mitochondrial morphology analysis (microscopy)

    • Mitochondrial inheritance quantification during cell division

    • Mitochondrial membrane potential measurements

    • Respiratory chain function assessment

These approaches can be combined with comparative studies between K. lactis and S. cerevisiae to leverage the predominantly respiratory metabolism of K. lactis , potentially revealing functional aspects of AIM34 that might be less apparent in fermentative yeasts.

How does the K. lactis respiratory metabolism impact experimental design for AIM34 functional studies?

The predominantly respiratory metabolism of K. lactis creates both opportunities and considerations for AIM34 research:

Experimental Design Considerations:

  • Growth conditions:

    • Carbon source selection is critical (glucose vs. galactose vs. non-fermentable carbon sources)

    • Oxygen availability must be carefully controlled

    • Growth in YPGal medium (1% yeast extract, 2% peptone, 2% galactose) or YPGlu medium (1% yeast extract, 2% peptone, 2% glucose) at 30°C is standard

  • Phenotypic analyses:

    • Respiratory deficiency phenotypes may be more pronounced in K. lactis

    • Mitochondrial function metrics must be carefully validated

    • Growth rates will differ significantly from S. cerevisiae under identical conditions

  • Stress response analysis:

    • Oxidative stress responses may be more robust

    • Different ROS (reactive oxygen species) thresholds may apply

    • Hypoxia-induced oxidative stress manifestations will differ

  • Comparative approaches:

    • Parallel experiments in both K. lactis and S. cerevisiae can highlight respiratory vs. fermentative metabolism differences

    • Evolutionary conservation analysis between the species can identify core functions

This respiratory metabolic profile makes K. lactis particularly valuable for studying mitochondrial proteins like AIM34, potentially revealing functional aspects that would be obscured in predominantly fermentative yeasts.

What quality control measures should be implemented when working with recombinant AIM34?

Rigorous quality control is essential when working with recombinant AIM34. The following validation steps are recommended:

Physical Characterization:

  • Purity assessment: SDS-PAGE analysis (>90% purity expected)

  • Concentration determination: Bradford/BCA assay calibrated with appropriate standards

  • Aggregation analysis: Size exclusion chromatography or dynamic light scattering

Functional Validation:

  • Antibody recognition: Western blot using anti-His antibodies or AIM34-specific antibodies

  • Subcellular localization: Mitochondrial fractionation studies to confirm proper targeting

  • Functional complementation: Rescue of phenotypes in AIM34-deficient strains

  • Interaction verification: Pull-down assays with known or predicted interaction partners

Storage Stability:

  • Thermal stability: Activity assessment after storage at different temperatures

  • Freeze-thaw stability: Comparative analysis after multiple freeze-thaw cycles

  • Buffer optimization: Testing alternative buffer components for enhanced stability

Implementing these quality control measures ensures experimental reproducibility and reliable interpretations of AIM34 functional studies.

How can transformation and selection systems be optimized for AIM34 research in K. lactis?

Effective transformation and selection strategies are critical for successful AIM34 research in K. lactis:

Transformation Methods:

  • Integrative transformation:

    • Linearized vectors targeted to the LAC4 chromosomal locus

    • Increases genetic stability for long-term studies

    • Provides consistent expression levels

  • Selection strategies:

    • Antibiotic selection: Geneticin (G418) at appropriate concentrations

    • Acetamide selection: Leverages the Aspergillus acetamidase (amdS) gene in nitrogen-free medium with acetamide

    • Auxotrophic complementation: Using ura3, his3, or trp1 markers in appropriate auxotrophic strains

Notably, acetamide selection has been shown to significantly enrich for transformants harboring multiple tandem-vector integrations (nearly 100% of transformants), compared to antibiotic selection with G418 . This can be particularly advantageous when higher expression levels are desired.

Optimization Parameters:

  • Integration frequency: Acetamide selection yields higher multiple integration rates

  • Expression levels: Multiple tandem insertions typically produce more heterologous protein

  • Stability: Integrated constructs provide greater stability than episomal vectors

  • Counterselection: Fluoroacetamide can be used to select for cells that have lost the amdS gene

These strategic approaches enable precise genetic manipulation for AIM34 functional studies while maintaining stable expression across experimental timeframes.

What are the key considerations for experimental controls when studying AIM34 function?

Robust experimental design for AIM34 studies requires carefully selected controls:

Genetic Controls:

  • Empty vector controls: Essential for transformation experiments to distinguish vector effects from insert effects

  • AIM34 deletion controls: Complete knockout strains verify specificity of complementation

  • Point mutant controls: Conservative vs. non-conservative mutations help identify critical residues

  • Tagged protein controls: Identical proteins with different tags confirm tag-independent functions

Biochemical Controls:

  • Inactive protein controls: Heat-denatured or specifically inactivated AIM34 preparations

  • Related protein controls: Similar mitochondrial proteins to test function specificity

  • Species-specific controls: Parallel experiments in S. cerevisiae highlight K. lactis metabolism influences

Experimental Validation Controls:

  • Biological replicates: Minimum of three independent experiments

  • Technical replicates: Multiple measurements within each biological replicate

  • Growth condition controls:

    • Oxygen availability (aerobic vs. microaerobic conditions)

    • Carbon source variation (fermentable vs. non-fermentable)

    • Growth phase standardization (exponential vs. stationary)

  • Mitochondrial function controls:

    • Known mitochondrial inheritance mutants

    • Mitochondrial membrane potential standards

    • Respiratory chain inhibitors as positive controls

Implementation of these controls ensures experimental robustness and facilitates accurate interpretation of AIM34 functional data.

How can researchers investigate potential protein-protein interactions involving AIM34?

Several complementary approaches can be employed to characterize the AIM34 interactome:

Affinity-Based Methods:

  • Co-immunoprecipitation (Co-IP):

    • Express His-tagged AIM34 in K. lactis

    • Isolate mitochondria and solubilize membrane proteins

    • Perform pull-down using Ni-NTA or anti-His antibodies

    • Identify co-precipitating proteins by mass spectrometry

  • Proximity labeling:

    • Generate AIM34 fusions with BioID, TurboID, or APEX2

    • Express in K. lactis and activate labeling in vivo

    • Purify biotinylated proteins and identify by mass spectrometry

    • Validate spatial proximity through orthogonal methods

Genetic Interaction Methods:

  • Yeast two-hybrid screening:

    • Use AIM34 as bait against K. lactis cDNA library

    • Focus on mitochondrial and mitochondria-associated proteins

    • Validate interactions in mitochondrial context

  • Synthetic genetic arrays:

    • Cross AIM34 mutants with genome-wide deletion/mutation collection

    • Identify genetic interactions suggesting functional relationships

    • Quantify genetic interaction strength through growth rate analysis

Structural Biology Approaches:

  • Crosslinking mass spectrometry:

    • Apply chemical crosslinkers to isolated mitochondria

    • Identify crosslinked peptides involving AIM34

    • Model interaction interfaces based on crosslink constraints

  • Co-crystallization or Cryo-EM:

    • Purify AIM34 with interacting partners

    • Determine structural basis of interactions

    • Validate interactions through structure-guided mutagenesis

These methodologies, used in combination, can elucidate the protein interaction network of AIM34 and provide insights into its functional role in mitochondrial inheritance.

What genomic and mitochondrial diversity considerations impact AIM34 research across K. lactis strains?

The exceptional genetic diversity in K. lactis populations has significant implications for AIM34 research:

Genomic Diversity Considerations:

  • Population structure:

    • K. lactis shows remarkably high genetic diversity (π = 2.8 × 10^-2)

    • This is almost 10-fold higher than S. cerevisiae (π = 3 × 10^-3)

    • More than twice that of K. marxianus (π = 1.2 × 10^-2)

  • Strain selection impact:

    • Wild isolates show greater diversity than dairy isolates

    • Different ecological niches (dairy vs. natural environments) correlate with genetic divergence

    • Laboratory reference strains may not represent wild population diversity

Mitochondrial Genome Considerations:

  • Mitochondrial gene diversity:

    • Complete gene sequences available for ATP6, COX2, COX3, and CYTB genes across strains

    • High fragmentation prevents whole mitochondrial genome comparisons

    • ATP6 and COX2 genes effectively recapitulate population structure

  • Research implications:

    • Strain-specific variations in AIM34 sequence may exist

    • Mitochondrial inheritance mechanisms could differ between strains

    • Interaction partners may vary across the population

Experimental Design Recommendations:

  • Multi-strain validation: Test key findings across diverse K. lactis isolates

  • Sequence verification: Confirm AIM34 sequence in specific experimental strains

  • Comparative genomics: Use nucleotide diversity metrics to guide strain selection

  • Standardization: Use well-characterized strains like YRRL-Y1140 for reproducibility

This diversity represents both a challenge and opportunity for AIM34 research, potentially revealing functional adaptations across different ecological niches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.