Recombinant Kluyveromyces lactis Altered inheritance of mitochondria protein 39, mitochondrial (AIM39)

Shipped with Ice Packs
In Stock

Description

Introduction to Kluyveromyces lactis

Kluyveromyces lactis is a yeast species significant in both scientific research and industrial biotechnology . Its historical use in the food industry and ability to produce enzymes like lactase and bovine chymosin on a large scale contribute to its biotechnological importance . K. lactis is employed as a host for protein expression, with various strains, genetic techniques, and molecular tools available for this purpose .

Understanding AIM39 in Kluyveromyces lactis

The AIM39 protein in Kluyveromyces lactis is related to mitochondrial function, specifically the inheritance and maintenance of mitochondria. Research indicates that proper mitochondrial protein synthesis is essential for the viability of K. lactis .

Recombinant Production and Applications

Kluyveromyces lactis is utilized for the recombinant production of various proteins. The yeast's ability to be genetically modified allows for the expression of heterologous proteins, useful in diverse applications .

  • Food-Grade Expression: K. lactis is considered food-safe, making it suitable for expressing enzymes for food applications . For example, recombinant K. lactis strains have been engineered to express manganese peroxidases, which can degrade mycotoxins like aflatoxin B1 (AFB1) in food .

  • Vaccine Development: Recombinant K. lactis has been explored as a vaccine platform. Studies have shown the successful expression of viral proteins, such as the GP5 protein of porcine reproductive and respiratory syndrome virus (PRRSV), in K. lactis, suggesting its potential for use in vaccine development .

  • Protein Production: K. lactis can produce correctly processed and glycosylated proteins. It has been used to produce plant saposin-like proteins with antifungal activity, showcasing its versatility in producing bioactive compounds .

Genetic Tools and Techniques

Several genetic tools and techniques facilitate the use of K. lactis for recombinant protein production .

  • pKLAC Vectors: The pKLAC series of vectors are commonly used for gene integration at the LAC4 promoter locus in K. lactis . These vectors can integrate tandemly, allowing for the co-expression of multiple proteins .

  • Transformation: Recombinant plasmids are transferred into K. lactis hosts, and transformants are selected and verified using PCR amplification .

  • Inducible Expression: Recombinant strains can be induced to express target proteins by growing them in specific media, such as YEPG liquid for manganese peroxidase expression .

Case Studies and Examples

ProteinHost StrainVectorApplication
Manganese Peroxidase (Mnp)GG799(pKLAC1-Phc mnp)pKLAC1Degradation of aflatoxin B1 (AFB1) in food. Supernatant of recombinant strain GG799(pKLAC1-Phc mnp) had the highest degradation ratio for AFB 1 (50.52 ± 3.69%) .
PRRSV GP5GG799pKLAC1Vaccine development for porcine reproductive and respiratory syndrome virus. Recombinant K. lactis induced T-cell proliferation and cytokine expression .
PSI of cirsinNot applicablepKLAC1Production of antifungal proteins. Yields of ∼4.0 mg/liter were achieved for both wild-type and non-glycosylated PSIs .
AIM31E. coliHis-TaggedRecombinant Kluyveromyces Lactis Altered Inheritance Of Mitochondria Protein 31, Mitochondrial(Aim31) Protein, His-Tagged, fused to N-terminal His tag, was expressed in E. coli .

Product Specs

Form
Lyophilized powder Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes if necessary. We will fulfill requests to the best of our ability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates. Note: All proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request with additional charges. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C. Lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process. The specific tag type is determined during production. If you require a particular tag, please inform us; we will prioritize its development.
Synonyms
AIM39; KLLA0B08734g; Altered inheritance of mitochondria protein 39, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
31-340
Protein Length
full length protein
Species
Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)
Target Names
AIM39
Target Protein Sequence
NHTDSKHYFTDPKTNEIKKPPTFFQHHDSKVNASADDVAQAIAESVRAHKKRRQKVFFSA MLTGIIGVTLGFSISYKVLYKKQESFIPLVPSRKWHRLSAYDAQRVNIDEMKMLGKMRCL SVLTNHEMIREQFGIPLKTDTGEVPSVKSFEVWCEDQDPGVLGIVVRPIDATRDNDSRYH RTHGWHTIPGLFQWRMGTKPIKIRDKFDSFLKFIGVNTGDLLEVINPDREVGDFKYEYPL RKGDSFDGDDDRAMHIWFFGEIDLSQDAMVVFKGKYHVNVKLEQVDLLKKENDQLIRYVL YKNENDKKNG
Uniprot No.

Target Background

Database Links
Protein Families
AIM39 family
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein.

Q&A

What is Kluyveromyces lactis and why is it advantageous for recombinant protein expression?

Kluyveromyces lactis has emerged as one of the most important yeast species for research and industrial biotechnology. This Crabtree-negative species offers several advantages for recombinant protein expression:

  • High levels of protein secretion capability, making it an attractive alternative for protein production

  • Ability to grow to very high cell density, optimizing yield

  • Food-grade status, suitable for application in food or feed industries

  • Methanol-free growth media requirements

  • Capacity to express genes that may be toxic to E. coli due to the PLAC4-PBI promoter, which remains transcriptionally silent in E. coli systems

Since 1991, nearly 100 recombinant proteins have been successfully expressed in K. lactis, with 20% of these produced in recent years, demonstrating its growing importance in biotechnology applications .

What expression systems are available for K. lactis protein production?

Multiple expression systems have been developed specifically for K. lactis, including:

  • The pKLAC vector series (e.g., pKLAC1, pKLAC2), which contain variants of the strong K. lactis LAC4 promoter (PLAC4-PBI)

  • Integration-based expression systems that allow for stable genetic modification

  • The New England Biolabs K. lactis Protein Expression Kit, which provides comprehensive tools for heterologous protein expression

For recombinant protein expression, the standard transformation process involves:

  • Cloning the gene of interest into an appropriate vector

  • Transforming the construct into K. lactis GG799 (or similar strain)

  • Selecting transformants based on appropriate markers

  • Screening for protein expression under inducible conditions

How should I design expression constructs for optimal AIM39 production in K. lactis?

When designing expression constructs for AIM39 or similar mitochondrial proteins in K. lactis, consider the following methodological approach:

  • Vector selection: pKLAC1 or pKLAC2 vectors are recommended due to their strong, inducible promoters

  • Signal sequence optimization:

    • For secreted expression: Include the α-mating factor signal sequence

    • For mitochondrial targeting: Consider native mitochondrial targeting sequences

    • For purification: Add appropriate tags (GST tags have been shown to increase solubility of aggregation-prone proteins)

  • Cloning strategy examples:

    • For native N-terminus: Design primers to amplify the coding sequence without signal sequence

    • For non-native N-terminus: Include desired modifications in your primer design

    • For C-terminal tagging: Include tag sequences (like hemagglutinin) in your reverse primer

  • Integration considerations: The pKLAC vectors integrate into the LAC4 promoter region of the K. lactis genome, allowing for stable expression

What cultivation and induction protocols are recommended for AIM39 expression?

Based on successful protocols for recombinant protein expression in K. lactis:

  • Initial cultivation:

    • Grow transformed K. lactis in YEPD (Yeast Extract Peptone Dextrose) medium until reaching OD600 of approximately 1.0

  • Induction protocol:

    • Transfer 1% of the culture to YEPG (Yeast Extract Peptone Galactose) medium to induce expression

    • For AIM39, as a mitochondrial protein, ensure aerobic conditions are maintained throughout cultivation

  • Expression monitoring:

    • Verify protein expression using appropriate assays (Western blotting, activity assays)

    • For mitochondrial proteins, subcellular fractionation may be required to confirm localization

  • Harvest timing:

    • Optimal harvest time must be determined empirically, but typically ranges from 48-96 hours post-induction

How can I optimize AIM39 expression for maximum yield and proper folding?

For optimizing expression of complex mitochondrial proteins like AIM39:

  • Culture optimization parameters:

    • Temperature: Generally 28-30°C, but lower temperatures (20-24°C) may improve folding

    • pH: Maintain between 4.5-6.0, with exact optimum determined empirically

    • Aeration: High aeration rates benefit mitochondrial protein expression

    • Carbon source: Galactose for induction, with possibility of glucose-galactose mixed feeding strategies

  • Strain enhancement:

    • Consider using specific K. lactis mutant strains with enhanced expression properties

  • Protein engineering approaches:

    • Adding GST tags has been demonstrated to increase solubility of aggregation-prone proteins

    • Consider fusion partners that may enhance folding or stability

What methods are recommended for purification and characterization of recombinant AIM39?

For mitochondrial proteins like AIM39, specialized purification strategies include:

  • Subcellular fractionation:

    • Enzymatic digestion of cell wall with zymolyase or lyticase

    • Gentle mechanical disruption to preserve mitochondrial integrity

    • Differential centrifugation to isolate mitochondrial fraction (typically 10,000-12,000 × g)

  • Protein extraction from mitochondria:

    • Solubilization with appropriate detergents (e.g., n-dodecyl β-D-maltoside)

    • Use of specialized buffers containing 50.0 mmol/l malonic acid buffer (pH 4.5) for optimal stability

  • Chromatography techniques:

    • Affinity chromatography if tags were incorporated

    • Ion exchange chromatography

    • Size exclusion chromatography for final polishing

  • Characterization methods:

    • Mass spectrometry to confirm protein identity and post-translational modifications

    • Circular dichroism for secondary structure analysis

    • Activity assays specific to predicted function

How can CRISPR/Cas9 technology be applied to study AIM39 function in K. lactis?

CRISPR/Cas9 has become a valuable tool for genetic manipulation in K. lactis . For studying AIM39:

  • Design strategy:

    • Design sgRNAs targeting the AIM39 gene (KLLA0B08734g)

    • Create deletion, point mutation, or tagged versions using appropriate repair templates

    • Consider using available K. lactis CRISPR vectors and protocols

  • Phenotypic analysis:

    • Growth assays under various conditions

    • Mitochondrial morphology and inheritance studies

    • Mitochondrial genome stability assessment

  • Verification methods:

    • PCR and sequencing to confirm genomic modifications

    • Western blotting to verify protein expression levels or modifications

    • Fluorescence microscopy for localization studies if using fluorescent tags

What approaches can I use to study AIM39's role in mitochondrial inheritance?

To investigate AIM39's role in mitochondrial function and inheritance:

  • Genetic approaches:

    • Create knockout strains using homologous recombination or CRISPR/Cas9

    • Generate point mutations at critical residues

    • Create double mutants with other mitochondrial proteins to study genetic interactions

  • Phenotypic characterization:

    • Mitochondrial genome stability assessments

    • Respiratory capacity measurements

    • Evaluation of mitochondrial morphology and distribution

    • Analysis of mitochondrial membrane potential using fluorescent dyes

  • Analysis of mitochondrial function in mutant strains:

    • Study of respiratory chain activity

    • Measurement of ATP synthesis

    • Analysis of mitochondrial protein import

    • Assessment of response to oxidative stress

K. lactis mutants with altered mitochondrial function often display distinct phenotypes related to their "petite-negative" nature, making them valuable models for studying essential mitochondrial processes .

How does AIM39 expression and function in K. lactis compare to other yeast species?

Comparative analysis between K. lactis and other yeast systems reveals important differences:

  • Mitochondrial differences between K. lactis and Saccharomyces cerevisiae:

    • K. lactis is petite-negative (cannot tolerate loss of mtDNA)

    • S. cerevisiae is petite-positive (can survive with extensive mtDNA deletions)

    • K. lactis has unique regulation of mitochondrial genes, including ethanol-responsive elements

  • Expression system differences:

    • K. lactis uses lactose/galactose induction

    • P. pastoris uses methanol induction

    • S. cerevisiae often uses galactose induction

  • Cellular localization considerations:

    • Mitochondrial proteins like AIM39 require proper targeting

    • K. lactis can achieve efficient organelle targeting with appropriate signals

    • Expression levels and processing may differ between species

What specific mutations in mitochondrial proteins have been studied in K. lactis, and how might similar approaches apply to AIM39?

Several mitochondrial protein mutations have been characterized in K. lactis:

  • F1-ATPase mutations:

    • Mutations in the β-subunit (MGI1) at Arg435 can convert K. lactis from petite-negative to petite-positive

    • Interactions between β-subunit, α-subunit (MGI2), and γ-subunit (MGI5) affect mitochondrial genome stability

  • Alcohol dehydrogenase mutations:

    • The aar900 mutation affects regulation of mitochondrial alcohol dehydrogenases (KlADH3 and KlADH4)

    • This mutation exhibits pleiotropic effects including resistance to monovalent cations and benomyl

  • Potential application to AIM39 research:

    • Site-directed mutagenesis of key residues in AIM39

    • Analysis of interactions with other mitochondrial proteins

    • Investigation of potential roles in maintaining mitochondrial membrane potential

Understanding these established mutation systems provides valuable methodological frameworks for studying novel mitochondrial proteins like AIM39.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.