Recombinant Kluyveromyces lactis ATP synthase subunit a (ATP6)

Shipped with Ice Packs
In Stock

Description

Functional Interactions and Pathways

ATP6 interacts with multiple subunits of the ATP synthase complex, forming a stator-stalk structure essential for rotational catalysis :

Interacting SubunitRole in ATP SynthaseInteraction ScoreSource
ATP5 (Subunit 5)Peripheral stalk component0.999
ATP1 (Subunit α)F₁ domain regulatory subunit0.999
ATP2 (Subunit β)Catalytic core (ATP synthesis)0.999
ATP9 (Subunit 9)Proton channel component0.999
COX3Cytochrome c oxidase (Complex IV)0.998

Assembly Pathways:

  • F₁/Atp9p pathway: Nuclear-encoded subunits assemble with mitochondrial-encoded ATP6 and ATP8 .

  • Peripheral stalk formation: Subunits ATP5, ATP16, and ATP7 stabilize the F₀-F₁ connection .

Biochemical Studies

  • Proton translocation: ATP6 mutations (e.g., in Saccharomyces cerevisiae) disrupt proton coupling, reducing ATP synthase efficiency .

  • Mitochondrial genome evolution: ATP6 and COX2 are key markers for phylogenetic analysis in K. lactis .

Biotechnological Uses

  • Protein production: Recombinant ATP6 is used in structural studies and enzyme assays .

  • ELISA reagents: Purified ATP6 serves as an antigen in immunoassays .

Pathological Insights

  • Disease models: Mutations in mitochondrial ATP6 are linked to ATP synthase dysfunction in human disorders .

  • Mitochondrial DNA integrity: mgi mutations in ATP6 restore viability in petite negative yeast strains .

Challenges and Future Directions

  • Heterologous expression: Efficient folding in E. coli requires optimized conditions .

  • Post-translational modifications: Glycosylation patterns in yeast systems remain under investigation .

  • High-throughput screening: Recombinant ATP6 aids in drug discovery targeting mitochondrial diseases .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
ATP6; ATP synthase subunit a; ATP synthase subunit 6; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
8-256
Protein Length
Full Length of Mature Protein
Species
Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)
Target Names
ATP6
Target Protein Sequence
SPLDQFEIRVLMGFTSPLLDFSSLNFTTFSLYTIIVLFTVLGLNLLTTNNNKIIGSKWFV SQEAIYDTILNMVKGQIGGKLWGYYFPLVYTFFFFIFVSNLISMIPYSFALSAHLIFIVS LSSVIWLGATIIGLTKHGLVFFSLFVPGGTPLPLVPLLVLIELLSYFARAISLGLRLSSN VLSGHLLLIILGGLLFNLMSMSIITFVFGLIPGVGLLAIVVLEFAISVIQAYVWSILTSS YLKDVLYLH
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V) synthesizes ATP from ADP using the proton gradient across the mitochondrial membrane, generated by the respiratory chain's electron transport complexes. F-type ATPases comprise two domains: the extramembranous catalytic core F1 and the membrane proton channel F0, connected by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. A key component of the proton channel, subunit a likely plays a direct role in proton translocation across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of Kluyveromyces lactis ATP synthase subunit a (ATP6)?

Kluyveromyces lactis ATP synthase subunit a (ATP6) is a transmembrane protein component of the ATP synthase complex (Complex V). The recombinant full-length protein (UniProt ID: Q6DN61) spans amino acids 8-256 and contains a predominantly hydrophobic sequence consistent with its membrane-embedded nature. The amino acid sequence includes multiple transmembrane domains that form part of the proton channel within the ATP synthase complex . The protein's hydrophobic character is evident in its sequence, which contains numerous nonpolar amino acids arranged in patterns typical of membrane-spanning helices.

What expression systems are optimal for producing recombinant K. lactis ATP6 protein?

The recombinant K. lactis ATP6 protein has been successfully expressed in E. coli systems with an N-terminal His tag . This heterologous expression approach is effective for producing sufficient quantities for research purposes. When designing expression protocols, researchers should consider:

  • Codon optimization for the host organism

  • Induction conditions (temperature, inducer concentration, duration)

  • Cell lysis methods that effectively solubilize membrane proteins

  • Detergent selection for membrane protein extraction

For highly hydrophobic membrane proteins like ATP6, specialized expression strains designed for membrane protein production may yield better results than standard laboratory strains.

What purification strategies yield the highest purity K. lactis ATP6 preparations?

Purification of recombinant K. lactis ATP6 typically employs affinity chromatography utilizing the N-terminal His tag, followed by additional purification steps. Based on established membrane protein purification protocols, the following methodology is recommended:

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA or similar resins

  • Size exclusion chromatography to remove aggregates and non-specific contaminants

  • Ion exchange chromatography for removal of residual contaminants

The purified protein typically achieves >90% purity as assessed by SDS-PAGE . Throughout the purification process, maintaining the protein in appropriate detergent micelles is crucial for preventing aggregation and preserving native-like structure and function.

What are the optimal storage conditions for maintaining K. lactis ATP6 stability and activity?

The recombinant K. lactis ATP6 protein requires specific storage conditions to maintain stability:

Storage TypeRecommended ConditionsPurpose
Long-term-20°C or -80°C in Tris/PBS-based buffer with 6% trehalose, pH 8.0 Prevent protein degradation
Working aliquots4°C for up to one week Minimize freeze-thaw damage
Reconstituted0.1-1.0 mg/mL in deionized sterile water with 5-50% glycerol Maintain solubility and prevent aggregation

Repeated freeze-thaw cycles should be strictly avoided as they promote protein degradation and aggregation. Aliquoting the protein immediately after purification is strongly recommended to minimize the need for multiple freeze-thaw cycles .

How should researchers approach reconstitution of lyophilized K. lactis ATP6 preparations?

For optimal reconstitution of lyophilized K. lactis ATP6:

  • Briefly centrifuge the vial before opening to collect material at the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is standard)

  • Aliquot immediately to avoid repeated freeze-thaw cycles

  • Store reconstituted aliquots at -20°C/-80°C for long-term storage or at 4°C for short-term use

This procedure ensures maximum retention of protein structure and function while minimizing aggregation that can occur during the reconstitution process.

How can functional reconstitution systems be optimized for K. lactis ATP6 activity assays?

Functional reconstitution of membrane proteins like ATP6 requires careful attention to lipid composition and reconstitution methodology. For K. lactis ATP6, researchers should consider:

  • Liposome preparation: Using lipid mixtures that mimic the native mitochondrial inner membrane composition

  • Reconstitution ratio: Optimizing protein-to-lipid ratios to prevent aggregation while ensuring sufficient protein incorporation

  • Proton gradient establishment: Creating pH gradients across proteoliposomes to drive ATP synthesis

  • Activity assays: Measuring ATP synthesis rates using luciferase-based assays or proton translocation using pH-sensitive fluorescent dyes

A methodical approach to reconstitution optimization will facilitate more reliable functional studies of this challenging membrane protein.

How does K. lactis ATP6 differ structurally and functionally from ATP6 in other yeast species?

K. lactis ATP6 shares substantial sequence homology with ATP6 proteins from other yeast species, but there are notable differences that may reflect evolutionary adaptations. K. lactis exhibits a distinct metabolic profile as a Crabtree-negative yeast, capable of adjusting its glycolytic flux to the requirements of respiration by tightly regulating glucose uptake . This metabolic characteristic may influence the functional properties of its ATP synthase components, including ATP6.

Comparing with Saccharomyces cerevisiae, K. lactis shows higher genetic diversity (θw = 3.3 × 10^-2 vs. θw = 1.6 × 10^-2 for S. cerevisiae) . This genetic diversity extends to its mitochondrial genes, potentially including ATP6, though the domesticated dairy populations show reduced diversity (θw = 1 × 10^-3) likely due to a domestication bottleneck .

What insights can be gained from comparing K. lactis ATP6 with human MT-ATP6?

Although K. lactis ATP6 and human MT-ATP6 serve analogous functions in their respective ATP synthase complexes, their specific sequences have diverged through evolution. Human MT-ATP6 mutations are associated with severe mitochondrial disorders such as Leigh syndrome, with specific mutations like T8993G impairing ATP synthase function and stability .

Comparative analysis between these proteins can:

  • Identify conserved residues crucial for proton translocation

  • Highlight species-specific adaptations in energy metabolism

  • Provide insights into pathogenic mechanisms of human ATP6 mutations

  • Guide the development of yeast models for studying human mitochondrial diseases

This comparative approach represents a valuable strategy for understanding fundamental principles of ATP synthase function across species.

What mutagenesis approaches are most effective for structure-function studies of K. lactis ATP6?

For structure-function analysis of K. lactis ATP6, site-directed mutagenesis offers powerful insights, particularly when targeting:

  • Conserved residues: Identified through multi-species sequence alignments

  • Predicted proton-conducting pathway: Residues lining the putative proton channel

  • Subunit interface residues: Amino acids likely involved in interactions with other ATP synthase components

Expression of mutant constructs in heterologous systems followed by purification and functional reconstitution allows assessment of specific residue contributions to:

  • Proton translocation efficiency

  • Complex assembly and stability

  • Coupling between proton flow and ATP synthesis

Complementary approaches including in vivo studies in ATP6-deficient yeast strains can validate findings from in vitro experiments.

How can molecular dynamics simulations enhance our understanding of K. lactis ATP6 function?

Molecular dynamics simulations offer valuable insights into the dynamic behavior of membrane proteins like ATP6 that are challenging to study experimentally. For K. lactis ATP6, simulations can address:

  • Proton pathway identification: Mapping potential routes for proton translocation through the protein

  • Conformational dynamics: Analyzing structural changes during the catalytic cycle

  • Lipid-protein interactions: Investigating how the membrane environment influences protein function

  • Water molecule behavior: Tracking water networks that may facilitate proton transfer

These computational approaches, when combined with experimental validation, can significantly advance our mechanistic understanding of ATP6 function within the ATP synthase complex.

What strategies can address poor expression yields of recombinant K. lactis ATP6?

Membrane proteins like ATP6 often present expression challenges. To improve yields:

  • Expression vector optimization: Adjust promoter strength, codon usage, and fusion tags

  • Host strain selection: Test specialized strains designed for membrane protein expression

  • Induction parameters: Optimize temperature, inducer concentration, and expression duration

  • Culture conditions: Consider using enriched media or supplementation with specific compounds that enhance membrane protein expression

  • Fusion constructs: Test expression with solubility-enhancing fusion partners

Systematic optimization of these parameters can significantly improve recombinant protein yields.

How can researchers overcome aggregation issues during purification and storage?

Aggregation represents a common challenge when working with hydrophobic membrane proteins like ATP6. Effective strategies include:

  • Detergent screening: Test multiple detergent types and concentrations to identify optimal solubilization conditions

  • Addition of stabilizing agents: Include glycerol, trehalose, or specific lipids in buffers

  • Temperature control: Maintain samples at 4°C during purification procedures

  • Buffer optimization: Adjust pH, ionic strength, and specific ion concentrations

  • Rapid processing: Minimize time between purification steps to reduce aggregation opportunities

Implementation of these approaches can significantly improve protein quality and experimental outcomes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.