Recombinant Kluyveromyces lactis Autophagy-related protein 32 (ATG32)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested. Advance notice is required for dry ice shipments, and additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag type, please inform us; we will prioritize its inclusion in the production process.
Synonyms
ATG32; KLLA0A00660g; Autophagy-related protein 32
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-524
Protein Length
full length protein
Species
Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)
Target Names
ATG32
Target Protein Sequence
MSGSKGVWGAPPGNNNRQLYSLDAGSSGSGVSASSAQRHSILDPHDSVMDLLNGQQSCAF DSRLIQNQDLIDRKGKSNNIDHNDINTHTHSKGLTDSWQAIDRDEYSFLNAGNHNNYHNT SNGDFNQQFGGVLSSDTSEEEVEINAAPSPNLSASQQHNQFLAYPLSSTGFGDQGNSETT VHQFSDGDPVKSTKTGQFSKAELGAGTGEDETIMVNLGHSWAGSFFVMPKLSLSESMKRF KILILSDGDSANSFYNRLSRYHRLMFDVGKLNEASKEEALKYTAFMIIFSDSKKVTTILN RMWKKYGDFTLIPICQKGQKQSVTEKVKTFANSNKIKLMSYPVVISDHYEIHGLLRHLHS LYVEVDSDYETDIPKKTKPRKGAKKKPAPHLAKRWWFWPISIALGVGIGCCVTFYFSKFE TSSYNSSVGVIQTADKEIDAIVDAIEGNSPSILEESSPQSISDFLGQVCKLVKDTAIQIN ELLKQFLSAHLMTSAWIQSIGKEFMQPDSQSTISKVTALDLVMF
Uniprot No.

Target Background

Function
ATG32 is a mitophagy-specific receptor that recruits the autophagic machinery to mitochondria, regulating their selective degradation. This process, mitophagy, maintains mitochondrial quantity and quality by removing excess or damaged mitochondria to meet cellular energy demands and prevent excessive ROS production. ATG32 recruits ATG11 to the mitochondrial surface and also promotes autophagy-dependent peroxisome degradation.
Database Links
Protein Families
ATG32 family
Subcellular Location
Mitochondrion outer membrane; Single-pass membrane protein. Vacuole membrane; Single-pass membrane protein. Preautophagosomal structure membrane; Single-pass membrane protein.

Q&A

What is ATG32 and what is its fundamental role in yeast cellular processes?

ATG32 is a transmembrane protein essential for mitochondrial autophagy (mitophagy) in yeast. It serves as a receptor protein that confers selectivity for mitochondrial sequestration as cargo during the autophagy process. In yeast systems, ATG32 is specifically required for mitophagy but not for other types of selective autophagy or for non-specific macroautophagy . The protein localizes to the outer membrane of mitochondria with its N-terminal domain exposed to the cytosol and C-terminal domain in the mitochondrial intermembrane space . Following mitophagy induction, ATG32 binds to ATG11, an adaptor protein for selective types of autophagy, and is subsequently recruited to and imported into the vacuole along with mitochondria . This process is essential for mitochondrial quality and quantity control, which is evolutionarily conserved from yeast to humans .

What are the optimal storage and handling conditions for recombinant K. lactis ATG32?

For optimal preservation of recombinant K. lactis ATG32 protein activity, researchers should follow these storage and handling protocols:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (optimally 50%) for long-term storage

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles

  • For short-term use, working aliquots can be stored at 4°C for up to one week

  • Avoid repeated freezing and thawing as this can compromise protein integrity

The protein is typically supplied in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, which helps maintain stability during storage .

How can recombinant ATG32 be used to study the mechanism of mitophagy in vitro?

Recombinant ATG32 serves as a valuable tool for investigating mitophagy mechanisms through several experimental approaches:

  • Interaction studies: Purified recombinant ATG32 can be used in pull-down assays, surface plasmon resonance, or isothermal titration calorimetry to quantitatively measure binding affinities with partners like ATG8 and ATG11 .

  • Structural analysis: The protein can be utilized for crystallography studies, as demonstrated with the ATG32 AIM peptide binding to ATG8, providing insights into the molecular interface of these interactions .

  • Reconstitution experiments: Researchers can design in vitro systems with purified components to reconstitute early events in mitophagy initiation, particularly focusing on complex formation between ATG32, ATG8, and ATG11 .

  • Domain function analysis: By creating truncated or chimeric constructs, researchers can determine which domains are necessary and sufficient for specific functions, similar to experiments showing that the cytosolic domain of ATG32 can direct autophagy machinery to peroxisomes when artificially targeted there .

These applications provide mechanistic insights into how ATG32 functions as an autophagic degron and initiates assembly of core ATG proteins on the mitochondrial surface .

What methods are effective for monitoring ATG32-dependent mitophagy in yeast systems?

Several robust methods can be employed to monitor and quantify ATG32-dependent mitophagy:

  • GFP processing assay: This semi-quantitative method employs mitochondrial proteins tagged with GFP (e.g., Om45-GFP). During mitophagy, these fusion proteins are delivered to the vacuole where the GFP moiety is cleaved but remains relatively stable. The accumulation of free GFP can be monitored by western blot, with the ratio of free GFP to the full-length fusion protein indicating the level of mitophagy .

  • Fluorescence microscopy: Mitochondrially-targeted fluorescent proteins like mito-DHFR-mCherry can be used to visualize the translocation of mitochondria to the vacuole. Colocalization with vacuolar membrane markers (e.g., Vph1-mCherry) confirms mitophagy .

  • Biochemical fractionation: Following mitophagy induction, researchers can isolate vacuoles and analyze the presence of mitochondrial proteins by western blotting to quantify mitophagy.

  • Electron microscopy: This technique allows direct visualization of mitochondria within autophagosomes or vacuoles.

The effectiveness of these methods can be verified using positive controls (wild-type cells) and negative controls (atg1Δ or atg11Δ mutants, which are defective in autophagy) .

What are the key experimental conditions for inducing mitophagy in K. lactis?

While specific conditions for K. lactis are not directly addressed in the provided search results, mitophagy induction conditions in yeast generally include:

  • Respiratory growth followed by nitrogen starvation: Cells are first grown in medium containing a non-fermentable carbon source (e.g., lactate or glycerol) to promote mitochondrial proliferation and then shifted to nitrogen starvation medium (SD-N) .

  • Post-logarithmic phase growth in lactate medium: Extended growth in lactate medium (YPL) past the logarithmic phase induces mitophagy .

  • Upregulation of ATG32 expression: Growth in glycerol medium increases ATG32 protein levels 10-20 fold compared to glucose-grown cells, which facilitates mitophagy .

For experiments specifically with K. lactis, researchers should adapt these protocols based on the physiology of this yeast species, potentially adjusting carbon sources and starvation conditions to achieve optimal mitophagy induction.

How does ATG32 interact with the core autophagy machinery?

ATG32 serves as a platform that recruits the core autophagy machinery to mitochondria through specific protein-protein interactions:

  • ATG8 interaction: ATG32 contains an ATG8-family interacting motif (AIM) that binds directly to ATG8, a ubiquitin-like protein that becomes conjugated to phosphatidylethanolamine (PE) in autophagosomes. This interaction is critical for efficient mitophagy, as mutations in the AIM (e.g., WQAI to AQAA) or in the AIM-binding interface of ATG8 (P52A/R67A) reduce mitophagy .

  • ATG11 interaction: ATG32 also binds ATG11, a scaffold protein required for selective autophagy. Following mitophagy induction, this interaction recruits ATG32-containing mitochondria to the phagophore assembly site. Variants of ATG32 that cannot stably interact with ATG11 show severe defects in mitochondrial degradation .

  • Complex formation: ATG32 forms a complex with ATG8 and ATG11 prior to and independent of isolation membrane generation and subsequent autophagosome formation, indicating that ATG32 acts at the earliest stages of mitophagy initiation .

X-ray crystallography has revealed that the ATG32 AIM peptide binds ATG8 in a conserved manner, providing structural insights into this key interaction .

What is the significance of the cytosolic domain of ATG32?

The cytosolic domain of ATG32 plays a crucial role in mitophagy and has several important functions:

  • Sufficiency for mitophagy: The cytosolic domain alone is fully capable of targeting the core autophagy machinery to mitochondria, indicating that the intermembrane space (IMS) domain is dispensable for the basic mitophagy function .

  • Transferable degron activity: When artificially anchored to peroxisomes, the ATG32 cytosolic domain can promote autophagy-dependent peroxisome degradation (pexophagy), demonstrating that it contains a degron-like module capable of directing autophagy machinery to other organelles .

  • Protein interaction hub: This domain harbors the binding sites for both ATG8 (via the AIM) and ATG11, which are essential interactions for recruiting autophagy machinery .

  • Direct initiation of autophagosome formation: The cytosolic domain directly initiates assembly of core ATG proteins on the mitochondrial surface, acting as an autophagic degron specific for autophagy-dependent degradation .

These findings suggest that ATG32 is the sole mitochondrial protein necessary and sufficient to directly mediate mitophagy, with its cytosolic domain containing all essential functions for this process .

How do mutations in the ATG8-binding motif affect ATG32 function?

Mutations in the ATG8-binding motif of ATG32 have significant but complex effects on its function:

  • Reduction in ATG8 binding: The WQAI to AQAA mutation in the ATG8-family interacting motif (AIM) of ATG32 reduces binding to ATG8 in yeast two-hybrid systems, though some interaction is still detected in coimmunoprecipitation assays, suggesting additional protein-protein interfaces may contribute to ATG32-ATG8 interaction in vivo .

  • Mild mitophagy defects: Cells expressing ATG32 with the AQAA mutation show only mild defects in mitophagy, maintaining approximately 88% of wild-type levels .

  • Synthetic defects in combination with ATG8 mutations: When combined with mutations in the AIM-binding interface of ATG8 (P52A/R67A), the ATG32 AQAA mutation causes synthetic defects in mitochondrial degradation, reducing mitophagy to approximately 60% of wild-type levels .

  • Impact on pre-autophagosomal complex formation: These mutations affect the ability of ATG32 to efficiently form complexes with ATG8 and ATG11 prior to isolation membrane generation, demonstrating their importance in the early stages of mitophagy .

These findings suggest that the interaction between ATG32 and ATG8 is crucial for mitophagy and that the free form of ATG8 can bind ATG32 on the mitochondrial surface prior to its PE conjugation and membrane anchoring to autophagosomes .

What experimental approaches can distinguish between the roles of ATG32 in different selective autophagy pathways?

To distinguish ATG32's specific role in mitophagy from other selective autophagy pathways, researchers can employ these experimental approaches:

  • Parallel pathway analysis: Researchers can simultaneously monitor different selective autophagy pathways in the same cells to determine specificity:

    • Mitophagy: Using markers like Om45-GFP or mito-DHFR-mCherry

    • Cytoplasm-to-vacuole targeting (Cvt) pathway: Monitoring prApe1 maturation

    • Pexophagy: Tracking Pex14-GFP processing

  • Genetic approaches:

    • Compare atg32Δ mutants with atg1Δ (defective in all autophagy) and atg11Δ (defective in selective autophagy)

    • atg32Δ shows defects only in mitophagy while maintaining normal function in the Cvt pathway and pexophagy, confirming its mitophagy-specific role

  • Chimeric protein studies: By fusing the ATG32 cytosolic domain to peroxisomal targeting sequences, researchers demonstrated that this domain can promote pexophagy when artificially localized to peroxisomes, indicating its potential as a universal organelle-specific autophagy adaptor

  • Interaction profiling: Analyze protein interaction networks specific to each pathway to identify unique and shared components

These approaches have established that ATG32 is specifically required for mitophagy but not for other selective autophagy pathways or nonspecific macroautophagy .

What are the methodological challenges in working with recombinant ATG32 and how can they be addressed?

Working with recombinant ATG32 presents several methodological challenges that researchers should consider:

  • Protein solubility and stability:

    • Challenge: As a transmembrane protein, full-length ATG32 may have solubility issues

    • Solution: Express the cytosolic domain separately, which contains most functional elements , or use appropriate detergents for full-length protein

  • Post-translational modifications:

    • Challenge: E. coli-expressed recombinant protein lacks yeast-specific modifications

    • Solution: For studies requiring native modifications, consider expression in yeast systems or in vitro modification after purification

  • Functional assays:

    • Challenge: Determining if recombinant protein retains native activity

    • Solution: Develop in vitro reconstitution assays with purified components to test interactions and complex formation

  • Storage and handling:

    • Challenge: Protein degradation during storage

    • Solution: Store at -20°C/-80°C, add 5-50% glycerol to the storage buffer, aliquot to avoid freeze-thaw cycles, and use working aliquots at 4°C for up to one week

  • Domain preservation:

    • Challenge: Ensuring the correct folding of functional domains

    • Solution: Validate protein structure and function through binding assays with known partners like ATG8 and ATG11

Addressing these challenges is crucial for obtaining reliable and reproducible results when working with recombinant ATG32 proteins.

How can researchers design experiments to study the evolutionary conservation of ATG32 function across different yeast species?

To investigate evolutionary conservation of ATG32 function across yeast species, researchers can employ these experimental approaches:

  • Comparative sequence analysis:

    • Align ATG32 sequences from different yeast species (S. cerevisiae, K. lactis, etc.)

    • Identify conserved domains, motifs, and binding sites, particularly the AIM and ATG11-binding regions

    • Generate phylogenetic trees to understand evolutionary relationships

  • Complementation studies:

    • Express K. lactis ATG32 in S. cerevisiae atg32Δ mutants to test functional rescue

    • Quantify mitophagy restoration using established assays (GFP processing, microscopy)

    • Create chimeric proteins with domains from different species to map functional conservation

  • Structural biology approaches:

    • Compare crystal structures of AIM peptides from different species binding to ATG8

    • Conduct structural analysis of ATG32-ATG11 interactions across species

  • Interactome analysis:

    • Perform comparative proteomics to identify ATG32 interaction partners in different yeast species

    • Use techniques like BioID or proximity labeling to map the protein neighborhood of ATG32

  • Functional domain swapping:

    • Create hybrid proteins with domains from different species to identify functionally interchangeable regions

    • Test these constructs in appropriate functional assays

These approaches would help determine whether ATG32's role as an autophagic degron and direct initiator of mitophagy is indeed a "common molecular feature in mitochondria autophagy conserved from yeast to humans" as suggested by research findings .

What are the critical quality control parameters for recombinant ATG32 protein preparations?

To ensure high-quality recombinant ATG32 protein preparations for experimental use, researchers should evaluate these critical parameters:

  • Purity assessment:

    • SDS-PAGE analysis: Confirm >90% purity with appropriate molecular weight band

    • Mass spectrometry: Verify protein identity and detect potential contamination or degradation

    • Western blot: Use anti-His antibodies to confirm tag presence and integrity

  • Protein folding and integrity:

    • Circular dichroism (CD) spectroscopy: Assess secondary structure

    • Fluorescence spectroscopy: Evaluate tertiary structure

    • Size exclusion chromatography: Detect aggregation or oligomerization

  • Functional validation:

    • Binding assays: Confirm interaction with ATG8 and ATG11

    • ATPase activity (if applicable): Measure enzymatic activity

    • Thermal shift assays: Assess protein stability

  • Contaminant testing:

    • Endotoxin testing: Particularly important for immunological studies

    • Nucleic acid contamination: Measure A260/A280 ratio

    • Protease activity: Test for proteolytic contaminants

  • Storage stability:

    • Freeze-thaw stability: Test activity after multiple freeze-thaw cycles

    • Temperature sensitivity: Compare activity at different storage temperatures

    • Buffer optimization: Assess stability in different buffer formulations

The product information indicates that commercially available recombinant K. lactis ATG32 protein typically has >90% purity as determined by SDS-PAGE , which serves as a basic quality control benchmark.

How can researchers troubleshoot experiments involving ATG32-mediated mitophagy?

When troubleshooting experiments involving ATG32-mediated mitophagy, researchers should consider these common issues and solutions:

ProblemPossible CausesTroubleshooting Strategies
Low or absent mitophagyInsufficient induction conditions- Verify growth in non-fermentable carbon source (lactate/glycerol)
- Confirm nitrogen starvation conditions
- Extend post-log phase incubation
ATG32 expression issues- Check ATG32 levels by western blot
- Verify growth conditions increase ATG32 (10-20 fold in glycerol vs. glucose)
Defective autophagy machinery- Use atg1Δ and atg11Δ as controls
- Test general autophagy with other assays
Poor ATG32-ATG8 bindingMutation in binding interface- Create binding site mutations in trans (both proteins)
- Try multiple binding assays (two-hybrid, co-IP)
Buffer/salt conditions- Optimize binding buffer conditions
- Test different detergents for membrane proteins
Inconsistent mitophagy measurementAssay variability- Use multiple complementary assays
- Include proper controls
- Standardize growth conditions
GFP processing issues- Check vacuolar protease activity
- Verify fusion protein expression
ATG32 localization problemsImproper targeting- Confirm mitochondrial localization with microscopy
- Verify membrane insertion with fractionation

Additionally, researchers should include appropriate controls in every experiment:

  • Wild-type cells (positive control)

  • atg1Δ (negative control for all autophagy)

  • atg11Δ (negative control for selective autophagy)

  • atg32Δ (specific for mitophagy defects)

What are the most effective protein expression systems for producing functional recombinant ATG32?

Several expression systems can be employed for producing functional recombinant ATG32, each with distinct advantages for different experimental applications:

  • E. coli expression system:

    • Advantages: High yield, cost-effective, simple culture conditions

    • Best for: Cytosolic domain expression, structural studies, binding assays

    • Limitations: Lacks post-translational modifications, potential folding issues for membrane proteins

    • Current commercial production uses this system with N-terminal His tags

  • Yeast expression systems:

    • Advantages: Native post-translational modifications, proper folding of yeast proteins

    • Best for: Full-length ATG32 including transmembrane domain, functional studies

    • Options: S. cerevisiae (well-characterized), K. lactis (potentially better for K. lactis ATG32)

    • Limitations: Lower yield than bacterial systems, more complex purification

  • Insect cell expression:

    • Advantages: Eukaryotic processing, good for membrane proteins

    • Best for: Full-length ATG32, complex formation studies

    • Limitations: More expensive, technically demanding

  • Cell-free expression systems:

    • Advantages: Rapid, allows toxic protein expression, direct incorporation of modified amino acids

    • Best for: Domain mapping, interaction studies, incorporation of biophysical probes

    • Limitations: Typically lower yield, higher cost

What are the emerging research questions regarding ATG32 function in mitophagy regulation?

Several cutting-edge research questions remain to be fully addressed regarding ATG32 function:

  • Regulation of ATG32 expression and activity:

    • How is ATG32 upregulated 10-20 fold during respiratory growth?

    • What are the transcriptional regulators and signaling pathways involved?

    • Are there post-translational modifications that regulate ATG32 activity?

  • Structural determinants of selectivity:

    • What structural features allow ATG32 to function as an organelle-specific adaptor?

    • How does the structural arrangement of ATG32-ATG8-ATG11 complexes promote specific mitochondrial recognition?

  • Conservation and evolution:

    • Are there functional homologs of ATG32 in higher eukaryotes?

    • How have mitophagy receptors evolved across species?

  • Role in mitochondrial quality control:

    • How does ATG32 distinguish damaged from healthy mitochondria?

    • Is there a mechanism for selective targeting of dysfunctional mitochondrial regions?

  • Integration with other cellular pathways:

    • How does ATG32-mediated mitophagy coordinate with mitochondrial fission/fusion?

    • What is the relationship between ATG32 and other stress response pathways?

  • Degron-like properties:

    • Can the ATG32 cytosolic domain be engineered to target other cellular components for selective autophagy?

    • What are the minimal structural requirements for this degron function?

The finding that ATG32's cytosolic domain can promote autophagy of other organelles when artificially localized there opens possibilities for engineering selective autophagy receptors for biotechnological and therapeutic applications .

How can advanced imaging techniques enhance our understanding of ATG32 function?

Advanced imaging techniques offer powerful approaches to investigate ATG32 function with unprecedented spatial and temporal resolution:

  • Super-resolution microscopy:

    • Stimulated emission depletion (STED) microscopy can visualize ATG32 distribution on the mitochondrial surface below the diffraction limit

    • Photoactivated localization microscopy (PALM) and stochastic optical reconstruction microscopy (STORM) can map ATG32 clustering during mitophagy initiation

    • These techniques could reveal if ATG32 forms distinct microdomains on mitochondria during mitophagy

  • Live-cell imaging with fluorescent protein fusions:

    • Dual-color imaging of fluorescently tagged ATG32 and autophagy machinery components (ATG8, ATG11)

    • Time-lapse microscopy to capture the dynamics of complex formation and mitochondrial sequestration

    • FRET/FLIM approaches to measure protein-protein interactions in real-time

  • Correlative light and electron microscopy (CLEM):

    • Combine fluorescence microscopy of tagged ATG32 with electron microscopy to visualize ultrastructural details

    • Immunogold labeling to precisely localize ATG32 relative to forming autophagosomes

  • Single-molecule techniques:

    • Single-molecule tracking to measure ATG32 mobility in the mitochondrial membrane

    • Single-molecule pull-down assays to determine the stoichiometry of ATG32-ATG8-ATG11 complexes

  • Expansion microscopy:

    • Physical expansion of specimens to achieve super-resolution imaging with conventional microscopes

    • Could reveal spatial relationships between ATG32 and other mitochondrial proteins

These advanced imaging approaches would help address how ATG32 is distributed on the mitochondrial surface, how it clusters during mitophagy initiation, and how it recruits the autophagy machinery to form the initiator complex described in biochemical studies .

What are the potential applications of understanding ATG32 function for research on mitochondrial diseases?

Understanding ATG32 function has significant implications for research on mitochondrial diseases:

  • Therapeutic target development:

    • Identifying functional equivalents of ATG32 in human cells could provide targets for modulating mitophagy

    • Enhancing mitophagy could help clear damaged mitochondria in diseases characterized by mitochondrial dysfunction

    • Engineering ATG32-inspired synthetic receptors could allow targeted removal of specific mitochondrial populations

  • Diagnostic applications:

    • Understanding the molecular mechanisms of mitophagy could lead to biomarkers for mitochondrial quality control defects

    • Assays based on mitophagy receptor function could help identify mitochondrial turnover abnormalities

  • Disease modeling:

    • Knowledge of yeast ATG32 function provides a framework for studying mitophagy receptors in human disease models

    • The finding that ATG32 contains a module that can promote autophagy of other organelles suggests potential for engineering selective autophagy for therapeutic purposes

  • Cross-species conservation insights:

    • The significance of ATG32 research extends to human health as mitochondrial quality control through mitophagy is "conserved from yeast to humans"

    • Understanding the fundamental mechanisms in yeast can inform research on human mitophagy receptors like BNIP3, NIX, and FUNDC1

  • Drug discovery platforms:

    • Recombinant ATG32 proteins could be used in high-throughput screening assays to identify compounds that modulate mitophagy

    • Structure-based drug design targeting the interfaces between mitophagy receptors and autophagy machinery

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.