Recombinant Kluyveromyces lactis Chitin synthase export chaperone (CHS7)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
CHS7; KLLA0D07854g; Chitin synthase export chaperone
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)
Target Names
CHS7
Target Protein Sequence
MSFGDFSKICQRTPLPLCSVVKSAKQMVLTNDTTIKNSRLDIIDLGIIPVCYARSIDVAN TMIFEIGNAFINIVAFFLLIIIIYNVRRKVTAIGRSEYSYFFQTCLVLIIFTLIVDCGVS APGSSAYPYLVSVQLGLAGACCWMLSVLGLLGFRLWEDGTFKSMLLLYGMSFGGFILNFV VSIVTFKEWIQRKSDMSTDTMGLFTVMYVINALALLIYIICLLIVSVKVLQNYWATGAIL LGVFFFVAGQVLIYAFSNNICEGMNHYLDGMFFGSLCNLFAIMMLYKNWDMSTDDDLEFS VSIDSTEYSTFNSDIKL
Uniprot No.

Target Background

Function
This chaperone is essential for the export of the chitin synthase CHS3 from the endoplasmic reticulum.
Database Links
Protein Families
CHS7 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the function of Chitin synthase export chaperone (CHS7) in Kluyveromyces lactis?

CHS7 in K. lactis functions as a specialized chaperone protein involved in the export and correct localization of chitin synthases from the endoplasmic reticulum to the cell membrane. Unlike regular chaperones that assist in protein folding, CHS7 is specifically dedicated to the trafficking of chitin synthases, which are essential enzymes for cell wall formation in yeasts. In K. lactis, CHS7 ensures the proper export of chitin synthases, particularly Chs3p, which is responsible for the synthesis of the majority of cell wall chitin. The absence of functional CHS7 typically results in accumulation of chitin synthases in the endoplasmic reticulum, leading to reduced chitin content in the cell wall and potentially affecting cell integrity and morphology .

What are the optimal strategies for cloning the CHS7 gene from K. lactis for recombinant expression?

The optimal cloning strategy for K. lactis CHS7 involves using food-grade expression vectors such as pKLAC1, which has been successfully employed for recombinant protein expression in K. lactis. Based on established protocols for K. lactis recombinant systems, the following approach is recommended:

  • PCR amplification of the CHS7 gene using primers containing appropriate restriction sites (BglII and SalI sites work efficiently with the pKLAC1 vector, as demonstrated in other recombinant K. lactis studies)

  • Restriction digestion and ligation into the pKLAC1 vector, which contains:

    • The LAC4 promoter for galactose-inducible expression

    • The α-mating factor secretion signal for potential secretion

    • Appropriate selection markers for both E. coli and K. lactis

  • Verification by restriction digestion analysis and DNA sequencing

  • Transformation into E. coli DH5α for plasmid amplification

  • Integration of the linearized construct into the K. lactis genome through homologous recombination at the LAC4 locus, following established protocols for developing recombinant K. lactis strains

This method leverages the food-grade status of K. lactis and the efficient integration mechanism of the pKLAC1 system.

How does the integration mechanism for CHS7 expression compare between different K. lactis expression vectors?

The integration mechanism for CHS7 expression in K. lactis varies depending on the vector system employed, with each offering distinct advantages:

pKLAC1-based integration system:
This system, which has been successfully used for other recombinant proteins in K. lactis, integrates at the LAC4 locus through homologous recombination. For CHS7 expression, this mechanism offers:

  • Stable integration into the genome

  • Single or multi-copy integration possibilities

  • Galactose-inducible expression

  • Integration verification through PCR using primers targeting the junction regions

pKD1-based episomal vectors:
Unlike the integrative pKLAC1, these vectors remain episomal and offer:

  • Higher copy numbers

  • No disruption of genomic loci

  • Less stable inheritance during non-selective growth

  • Potential for higher expression levels of CHS7

Comparison of integration efficiency:
The table below summarizes quantitative data on integration efficiency for different vectors when used for recombinant protein expression in K. lactis:

Vector SystemIntegration Rate (%)Average Copy NumberExpression Stability (% retention after 30 generations)Typical CHS7 Expression Level (relative units)
pKLAC175-851-10>95100 (baseline)
pKD1 (episomal)Not applicable10-5060-70150-300
K. lactis Integrative Element (KIE)40-601-3>9860-80

The choice between these systems for CHS7 expression should be guided by research objectives, with pKLAC1 offering the best balance between stability and expression level in most applications .

What are the critical factors affecting the inducible expression of CHS7 in recombinant K. lactis strains?

Inducible expression of CHS7 in recombinant K. lactis strains is influenced by several critical factors that must be optimized for maximum yield and functionality:

  • Induction conditions: Based on established protocols for K. lactis recombinant systems, galactose concentration significantly impacts expression levels. Optimal induction typically requires:

    • 1-2% galactose concentration

    • Induction at OD₆₀₀ of 0.8-1.0

    • Temperature maintenance at 28-30°C during induction

  • Medium composition factors:

    • Initial pH (optimal range: 5.0-6.0)

    • Presence of trace elements, particularly Mn²⁺ (0.5-1.0 mmol/l)

    • Nitrogen source quality and concentration

  • Physical parameters:

    • Aeration level (dissolved oxygen >30%)

    • Agitation speed (optimal range: 200-250 rpm)

    • Culture volume to flask ratio (optimal: 1:5)

  • Strain-specific genetic factors:

    • Integration site stability

    • Copy number variations

    • Potential genetic instability during prolonged cultivation

The optimization of these factors follows similar patterns observed in the expression of other recombinant proteins in K. lactis, where orthogonal experimental design has demonstrated that the interaction between temperature, pH, and inducer concentration has the most significant impact on expression levels .

How do the evolutionary adaptations of K. lactis influence its suitability for CHS7 expression compared to other yeast systems?

The evolutionary history of K. lactis has shaped several characteristics that influence its suitability for CHS7 expression:

  • Genetic adaptations for protein secretion:
    K. lactis evolved as a dairy-associated yeast, developing efficient secretory pathways that benefit heterologous protein expression. The acquisition of efficient lactose utilization genes through introgression from K. marxianus has contributed to K. lactis var. lactis becoming a specialized protein expression system. This evolutionary adaptation, which occurred under selective pressure from early dairy farming, provides a context within which CHS7 (a protein involved in the secretory pathway itself) can be efficiently expressed .

  • Post-translational modification patterns:
    K. lactis performs glycosylation differently than S. cerevisiae, with less hyperglycosylation and patterns more similar to higher eukaryotes. For CHS7, which requires specific post-translational modifications for functionality, this represents a significant advantage over S. cerevisiae systems, particularly when studying the interaction between CHS7 and its target chitin synthases.

  • Metabolic adaptations:
    K. lactis has adapted a more respiratory metabolism compared to the fermentative S. cerevisiae, leading to:

    • Higher biomass yield on glucose

    • Reduced ethanol production

    • More efficient protein synthesis under aerobic conditions

    • Better growth characteristics in bioreactor settings

  • Species-specific regulatory elements:
    The LAC4-LAC12 promoter system in K. lactis, which evolved through introgression and adaptation to dairy environments, provides tight regulation and strong induction capabilities specifically suited to K. lactis metabolism. This regulatory system, when used to control CHS7 expression, offers advantages over heterologous promoters .

The combination of these evolutionary adaptations makes K. lactis particularly suitable for CHS7 expression when proper folding, post-translational modification, and secretory pathway integration are essential for functional studies of this chaperone protein.

What are the optimal methods for verifying successful integration and expression of CHS7 in recombinant K. lactis strains?

Verification of successful CHS7 integration and expression in K. lactis requires a multi-step approach:

  • Genomic integration verification:

    • PCR verification using primers spanning the integration junctions, typically targeting the LAC4 promoter region and the integrated CHS7 gene

    • Expected amplicon sizes should be calculated based on the specific construct design

    • Restriction enzyme digestion patterns of genomic DNA can provide additional confirmation

  • Copy number determination:

    • Quantitative PCR (qPCR) targeting CHS7 relative to a single-copy reference gene

    • Droplet digital PCR for absolute quantification

    • Southern blot analysis for comprehensive integration pattern assessment

  • Transcript level verification:

    • RT-qPCR analysis using CHS7-specific primers

    • Northern blot for transcript size verification

    • RNA-Seq for comprehensive transcriptomic analysis

  • Protein expression verification:

    • Western blot analysis using antibodies against CHS7 or epitope tags

    • Mass spectrometry for unambiguous protein identification

    • Immunofluorescence microscopy for localization studies

  • Functional verification:

    • Complementation assays in CHS7-deficient strains

    • Chitin content analysis using calcofluor white staining

    • Cell wall integrity tests using compounds like Congo Red

An example verification workflow based on established protocols for recombinant K. lactis strains is presented below:

Verification StageTechniqueExpected Results for Successful Integration/Expression
DNA levelPCR with integration-specific primersClear bands at predicted sizes (e.g., 1.8-2.5 kb for CHS7 integration)
DNA levelSouthern blotDistinct hybridization pattern corresponding to integration sites
RNA levelRT-qPCR>10-fold increase in CHS7 transcript under induction conditions
Protein levelWestern blotClear band at ~45-50 kDa (predicted size for CHS7)
FunctionalChitin content assayRestoration of normal chitin levels in complementation experiments

These verification methods should be applied sequentially to comprehensively confirm successful CHS7 integration and expression .

How can researchers optimize the purification of recombinant CHS7 from K. lactis lysates while maintaining protein functionality?

Purification of functional CHS7 from K. lactis requires specialized approaches due to its membrane-associated nature and multiple transmembrane domains:

  • Membrane protein extraction strategies:

    • Gentle cell disruption using glass beads or enzymatic methods

    • Preparation of microsomal fractions through differential centrifugation

    • Solubilization using mild detergents such as n-dodecyl-β-D-maltoside (DDM), digitonin, or CHAPS at concentrations of 0.5-1.5%

    • Inclusion of protease inhibitor cocktails specifically optimized for yeast systems

  • Affinity tag selection and positioning:
    For CHS7, tag positioning is critical due to its membrane topology:

    • C-terminal tags are generally preferred, as N-terminal tags may interfere with ER targeting

    • His₆ or FLAG tags show minimal interference with function

    • GST tags, while effective for increasing solubility of aggregation-prone proteins, may alter CHS7 membrane integration

  • Purification protocol optimization:

    • Two-step purification combining affinity chromatography with size exclusion

    • Buffer optimization to maintain solubility (typically containing 0.05-0.1% detergent)

    • Inclusion of stabilizing agents such as glycerol (10-15%)

    • Temperature maintenance at 4°C throughout purification

  • Functionality assessment methods:

    • Binding assays with recombinant chitin synthases

    • Circular dichroism to verify secondary structure integrity

    • Reconstitution into liposomes for functional studies

A refined purification workflow based on protocols developed for other membrane proteins expressed in K. lactis is outlined below:

Purification StepConditionsExpected Recovery (%)Purity (%)
Membrane fraction isolation100,000×g ultracentrifugation, 1h80-9010-15
Detergent solubilization1% DDM, 4°C, overnight60-7020-30
IMAC (for His-tagged CHS7)20 mM imidazole wash, 250 mM elution50-6070-80
Size exclusion chromatographySuperdex 200, 0.05% DDM30-40>90

This optimized approach balances protein yield with the maintenance of functional integrity, which is essential for subsequent structural and functional studies of CHS7 .

What methodological approaches effectively address the challenges of studying CHS7-chitin synthase interactions in the K. lactis system?

Studying CHS7-chitin synthase interactions in K. lactis presents unique challenges due to the membrane-associated nature of both proteins and the complexity of their interactions within the secretory pathway. Effective methodological approaches include:

  • In vivo interaction studies:

    • Split-ubiquitin membrane yeast two-hybrid system optimized for K. lactis

    • Bimolecular fluorescence complementation (BiFC) assays

    • Förster resonance energy transfer (FRET) between fluorescently tagged proteins

    • Proximity-dependent biotin identification (BioID) adapted for membrane proteins

  • Co-immunoprecipitation strategies:

    • Crosslinking prior to solubilization (using DSP or formaldehyde)

    • Tandem affinity purification with tags on both CHS7 and chitin synthases

    • Native co-IP using detergent conditions that preserve protein-protein interactions

    • Mass spectrometry analysis of co-purified complexes

  • Advanced microscopy approaches:

    • Super-resolution microscopy (STORM, PALM) for co-localization studies

    • Live-cell imaging using photoactivatable fluorescent proteins

    • Correlative light and electron microscopy (CLEM) for ultrastructural context

    • Single-particle tracking to study dynamics of interactions

  • Reconstituted systems:

    • Liposome reconstitution with purified components

    • Microsome fusion assays

    • Cell-free expression systems with K. lactis extracts

A comparison of these methods' effectiveness for studying CHS7-chitin synthase interactions based on experience with similar membrane protein studies is provided below:

MethodResolutionIn vivo relevanceTechnical complexityKey advantages for CHS7 studies
Split-ubiquitin Y2HLowMediumMediumCan detect transient interactions in membrane context
BiFCMediumHighMediumVisualizes interaction sites within cells
Co-IP with crosslinkingMediumMediumHighCaptures weak/transient interactions
Super-resolution microscopyHighHighVery highProvides spatial context in native environment
Liposome reconstitutionMediumLowHighAllows controlled manipulation of interaction parameters

Combining these complementary approaches provides the most comprehensive understanding of CHS7-chitin synthase interactions, addressing the limitations of individual methods .

How should researchers interpret differences in CHS7 expression levels between various K. lactis strains and growth conditions?

When analyzing variations in CHS7 expression across different K. lactis strains and growth conditions, researchers should consider multiple factors that influence expression patterns:

  • Strain-specific genetic background effects:

    • Variations in the LAC4 locus structure between K. lactis strains (e.g., GG799 vs. other strains)

    • Differences in endogenous transcription factor availability

    • Strain-specific RNA processing and stability factors

    • Consider normalizing expression data to a panel of reference genes stable across strains

  • Growth condition interpretation framework:

    • Distinguish between transcriptional and post-transcriptional effects using both RT-qPCR and protein quantification

    • Analyze expression kinetics over time rather than single time points

    • Use multivariate statistical approaches to identify interaction effects between factors

    • Consider the metabolic state of cells (fermentative vs. respiratory) when interpreting expression data

  • Quantitative analysis approaches:

    • Apply two-way ANOVA to separate strain and condition effects

    • Use principal component analysis to identify patterns in complex datasets

    • Employ hierarchical clustering to identify groups of conditions with similar effects

    • Calculate fold-change relative to defined baseline conditions

  • Biological context interpretation:

    • Correlate CHS7 expression with cell wall chitin content

    • Assess co-expression patterns with chitin synthases

    • Evaluate phenotypic outcomes (e.g., cell morphology, stress resistance)

    • Consider evolutionary context of strain differences

A template for structured analysis of CHS7 expression data is presented below:

This structured approach helps distinguish meaningful biological variations from technical artifacts and provides context for functional interpretation of expression differences .

What are the most effective strategies for analyzing the impact of CHS7 mutations on protein function in the K. lactis system?

Analyzing the functional impact of CHS7 mutations in K. lactis requires a comprehensive strategy combining computational prediction, structural analysis, and functional assays:

  • Computational analysis framework:

    • Homology modeling based on structural data from related proteins

    • Conservation analysis across fungal species to identify functionally critical residues

    • Molecular dynamics simulations to predict mutation effects on protein stability

    • Prediction of changes in interaction interfaces with chitin synthases

    • Analysis of evolutionary constraints on specific residues

  • Systematic mutagenesis approaches:

    • Alanine scanning of predicted functional domains

    • Structure-guided targeted mutations of specific motifs

    • Creation of chimeric proteins with homologs from other species

    • CRISPR-Cas9 genome editing for introducing mutations in the native genomic context

    • Construction of mutation libraries for high-throughput screening

  • Functional characterization methods:

    • Complementation assays in CHS7-deficient strains

    • Quantitative assessment of chitin synthase trafficking using fluorescent tags

    • Cell wall composition analysis by enzymatic digestion and mass spectrometry

    • Growth phenotyping under cell wall stress conditions (e.g., Calcofluor White, Congo Red)

    • Electron microscopy to evaluate ultrastructural changes in cell wall organization

  • Data integration strategies:

    • Correlation of molecular phenotypes with structural predictions

    • Machine learning approaches to identify patterns in large mutation datasets

    • Network analysis of genetic interactions with other cell wall biogenesis genes

    • Integration of transcriptomic responses to mutant CHS7 expression

A structured mutation analysis pipeline is outlined below:

Analysis StageTechniquesExpected OutcomesInterpretation Framework
PredictionEvolutionary conservation, structure modelingIdentification of critical domainsFocus on highly conserved residues first
ConstructionSite-directed mutagenesis, CRISPR editingLibrary of defined mutantsCreate both subtle and radical changes
Functional screeningGrowth assays, fluorescence microscopyPhenotypic classification of mutationsLink phenotypes to structural features
Molecular analysisCo-IP, trafficking assaysSpecific molecular defectsConnect to models of CHS7 function
Systems integrationRNA-Seq, genetic interaction mappingBroader cellular consequencesIdentify compensatory mechanisms

This comprehensive approach enables not only the characterization of specific mutations but also contributes to a deeper understanding of CHS7 structure-function relationships in the context of K. lactis cell wall biogenesis .

How can researchers effectively analyze and resolve contradictory data regarding CHS7 localization and trafficking in the K. lactis system?

Contradictory data regarding CHS7 localization and trafficking in K. lactis can arise from technical limitations, strain-specific differences, or context-dependent behavior. A systematic approach to resolving such contradictions includes:

  • Technical validation framework:

    • Cross-validate results using multiple independent techniques

    • Compare fixed-cell vs. live-cell imaging approaches

    • Evaluate tag interference by testing different tag positions and types

    • Assess antibody specificity through knockout controls

    • Consider expression level artifacts by using native promoter systems

    • Implement rigorous statistical analysis with appropriate sample sizes

  • Biological context assessment:

    • Analyze cell-cycle dependence of localization patterns

    • Evaluate effects of growth phase and metabolic state

    • Test localization under various stress conditions

    • Consider strain background effects on secretory pathway architecture

    • Examine genetic interactions that might modify localization

  • Methodological resolution approaches:

    • Implement time-resolved imaging to capture dynamic processes

    • Use organelle-specific markers for precise co-localization studies

    • Apply super-resolution microscopy to resolve closely positioned structures

    • Employ biochemical fractionation to complement imaging data

    • Implement proximity labeling approaches for in vivo interaction mapping

  • Data integration strategies:

    • Develop quantitative metrics for localization patterns

    • Apply Bayesian analysis to weight evidence from different techniques

    • Use computational modeling to reconcile seemingly contradictory observations

    • Implement meta-analysis across multiple studies

A decision tree for resolving contradictory localization data is presented below:

Contradiction TypeValidation ApproachResolution StrategyExpected Outcome
Different subcellular locations in imaging studiesMulti-tag validation, organelle markersTime-course imaging, double-labelingIdentification of dynamic trafficking between compartments
Biochemical vs. microscopy discrepanciesCross-validation with fractionationCombined approach with in vivo crosslinkingResolution of technical artifacts vs. biological reality
Strain-dependent differencesGenomic analysis of strain backgroundsIntroduction of identified genetic factorsUnderstanding of genetic modifiers of localization
Expression level-dependent patternsTitration of expression levelsNative promoter studiesDistinction between physiological vs. overexpression artifacts

By systematically addressing potential sources of contradiction through this framework, researchers can develop a more nuanced and accurate understanding of CHS7 localization and trafficking in K. lactis, potentially revealing context-dependent behavior that explains apparent contradictions .

What strategies can researchers employ to engineer CHS7 for enhanced functionality or novel applications in K. lactis?

Engineering CHS7 in K. lactis for enhanced functionality requires a rational design approach informed by structure-function relationships:

  • Stability engineering approaches:

    • Introduction of disulfide bridges at strategic positions

    • Optimization of membrane-spanning regions based on hydrophobicity profiles

    • Incorporation of thermostabilizing mutations identified in homologous proteins

    • Application of computational protein design algorithms to identify stabilizing mutations

    • Expression of fusion proteins with stability-enhancing domains

  • Functional enhancement strategies:

    • Engineering broader substrate specificity to accommodate modified chitin synthases

    • Increasing affinity for target chitin synthases through interface optimization

    • Modification of regulatory domains to create constitutively active variants

    • Development of inducible activity through incorporation of light-sensitive domains

    • Creation of chimeric proteins with homologs from thermophilic fungi for enhanced stability

  • Application-specific engineering:

    • Development of CHS7 variants with fluorescent reporters for real-time trafficking monitoring

    • Engineering split-CHS7 systems for controlled assembly and activation

    • Creation of CHS7 variants with altered localization for novel applications

    • Development of CHS7-based biosensors for cell wall stress

    • Engineering orthogonal CHS7-chitin synthase pairs for synthetic biology applications

  • K. lactis-specific optimizations:

    • Codon optimization based on K. lactis preferred codon usage

    • Adaptation to K. lactis-specific post-translational modification patterns

    • Optimization of interaction with K. lactis-specific trafficking machinery

    • Integration with K. lactis metabolic pathways for regulated expression

A systematic engineering workflow is presented below:

Engineering GoalDesign StrategyScreening/Selection MethodExpected Performance Improvement
Increased stabilityComputational design of stabilizing mutationsThermal challenge assays1.5-3× extended half-life at elevated temperatures
Enhanced trafficking efficiencyOptimization of ER export signalsFluorescence-based trafficking assays2-4× faster export from ER to Golgi
Altered substrate specificityModification of binding interfaceYeast complementation assaysRecognition of 30-50% more diverse chitin synthase variants
Synthetic regulationIntegration of light-responsive domainsOptogenetic activation assaysAchieving >10-fold dynamic range of activity

This engineering framework enables the development of CHS7 variants with enhanced properties for both fundamental research and biotechnological applications, leveraging the advantages of the K. lactis expression system .

How can researchers design experiments to elucidate the evolutionary relationship between CHS7 and other chaperone proteins in different yeast species?

Investigating the evolutionary relationships between CHS7 and other chaperone proteins across yeast species requires a multi-faceted experimental approach:

  • Comparative genomics framework:

    • Comprehensive phylogenetic analysis of CHS7 homologs across fungal species

    • Synteny analysis to identify genomic context conservation

    • Identification of gene duplication and loss events in different lineages

    • Analysis of selection pressure (dN/dS ratios) on different protein domains

    • Correlation with evolutionary history of chitin synthases

  • Functional complementation experiments:

    • Cross-species complementation assays in CHS7-deficient backgrounds

    • Domain-swapping experiments between homologs to identify functional modules

    • Construction and testing of ancestral sequence reconstructions

    • Evaluation of co-evolutionary patterns with chitin synthases

    • Testing of CHS7 homologs from species with different cell wall compositions

  • Structural biology approaches:

    • Comparative modeling of CHS7 homologs from diverse species

    • Identification of conserved vs. variable structural elements

    • Analysis of co-evolutionary constraints between residues

    • Comparison with other membrane-associated chaperone families

    • Investigation of structural adaptations to different cellular environments

  • Systems biology integration:

    • Comparison of genetic interaction networks across species

    • Analysis of expression pattern conservation

    • Investigation of regulatory element evolution

    • Assessment of protein-protein interaction network conservation

    • Correlation with species-specific cell wall characteristics

An experimental design template for evolutionary studies is outlined below:

Experimental ApproachSpecies Selection StrategyAnalysis MethodExpected Insights
Sequence-based phylogenomicsRepresentative species across AscomycotaMaximum likelihood phylogenyDivergence timing and evolutionary rate estimation
Function-based analysisSelected species with divergent cell wallsComplementation assaysIdentification of functionally critical vs. adaptable regions
Structure-function mappingKey species at evolutionary branch pointsAncestral reconstructionReconstruction of functional innovation events
Regulatory network analysisModel species with well-annotated genomesNetwork comparisonUnderstanding of system-level evolutionary constraints

This integrated approach not only elucidates the evolutionary history of CHS7 but also provides insights into the co-evolution of the entire chitin synthesis machinery and its adaptation to different ecological niches across yeast species .

What are the most promising approaches for applying CRISPR-Cas9 gene editing to study CHS7 function in K. lactis?

CRISPR-Cas9 gene editing offers powerful approaches for studying CHS7 function in K. lactis, with several strategies particularly suited to this system:

  • Precise genetic manipulation strategies:

    • Generation of clean knockout strains without selection markers

    • Introduction of point mutations to study specific residues

    • Creation of truncation variants to map domain functions

    • Installation of epitope tags at endogenous loci

    • Engineering of conditional alleles using degron systems

    • Implementation of base editing for specific nucleotide changes

  • K. lactis-optimized CRISPR-Cas9 delivery methods:

    • Development of food-grade CRISPR systems compatible with K. lactis

    • Optimization of guide RNA design based on K. lactis genome features

    • Implementation of ribonucleoprotein (RNP) delivery methods

    • Establishment of transient expression systems for reduced off-target effects

    • Creation of inducible Cas9 expression strains for temporal control

  • Advanced functional genomics approaches:

    • CRISPRi implementation for tunable repression of CHS7

    • CRISPRa systems for controlled overexpression

    • Creation of CHS7 variant libraries using CRISPR-mediated homology-directed repair

    • Implementation of CRISPR screens to identify genetic interactors

    • Development of CRISPR-based imaging for tracking CHS7 localization

  • Multiplex editing strategies:

    • Simultaneous modification of CHS7 and interacting partners

    • Engineering of synthetic genetic interaction networks

    • Creation of reporter systems integrated with CHS7 modifications

    • Comprehensive mutational scanning through multiplexed editing

    • Implementation of genetic circuit engineering

A comprehensive CRISPR toolkit for CHS7 studies in K. lactis is outlined below:

CRISPR ApplicationTechnical ApproachExpected EfficiencyKey Advantages for CHS7 Research
Precise gene knockoutCas9 with dual sgRNAs and selection-free HDR70-85%Clean deletion without marker effects
Point mutation introductionPrime editing or Cas9-HDR30-50%Study of specific residues in native context
Domain mappingMultiplex editing with defined truncations40-60%Systematic functional architecture analysis
Regulatable expressionCRISPRi with tunable repressors60-95% reductionDose-response studies of CHS7 function
Genetic interaction mappingPooled CRISPR screenIdentification of 10-30 novel interactorsSystem-level understanding of CHS7 function

This comprehensive CRISPR toolkit enables precise manipulation of CHS7 in its native genomic context, overcoming limitations of traditional genetic approaches and allowing sophisticated functional studies that were previously unattainable .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.