Recombinant Kluyveromyces lactis Cytochrome c oxidase subunit 2 (COX2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Kluyveromyces lactis Cytochrome c Oxidase Subunit 2 (COX2)

Recombinant Kluyveromyces lactis Cytochrome c oxidase subunit 2 (COX2) is a protein expressed in a recombinant system, typically in bacteria like Escherichia coli, rather than in Kluyveromyces lactis itself. This protein is part of the cytochrome c oxidase complex, which plays a crucial role in the electron transport chain of mitochondria, facilitating the transfer of electrons from cytochrome c to oxygen, thereby producing ATP .

Structure and Function of COX2

Cytochrome c oxidase is a large enzyme complex consisting of several subunits, with COX2 being one of them. In Kluyveromyces lactis, COX2 is encoded by the gene that spans amino acids 12 to 247. The recombinant form of this protein is often fused with an N-terminal His tag to facilitate purification and detection .

CharacteristicsDescription
Protein Length12-247 amino acids
Expression HostTypically Escherichia coli
TagN-terminal His tag
FunctionElectron transport in mitochondria

Applications and Research Findings

While specific research on recombinant Kluyveromyces lactis COX2 is limited, studies on similar proteins highlight their importance in understanding mitochondrial function and energy metabolism. The use of recombinant proteins like COX2 allows for detailed biochemical and structural analyses, which can provide insights into the mechanisms of electron transport and oxidative phosphorylation.

Expression and Purification

The expression of recombinant COX2 in Escherichia coli involves cloning the COX2 gene into an appropriate plasmid, followed by transformation into competent bacterial cells. The protein is then induced, typically using IPTG, and purified using affinity chromatography due to the His tag .

Analytical Techniques

Recombinant COX2 proteins are often analyzed using techniques such as SDS-PAGE to verify their molecular weight and purity. Western blotting can be used to confirm the presence of the His tag.

TechniquePurpose
SDS-PAGEMolecular weight and purity analysis
Western BlotConfirmation of His tag

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
COX2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
12-247
Protein Length
Full Length of Mature Protein
Species
Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)
Target Names
COX2
Target Protein Sequence
DVPTPYGMYFQDSATPNQEGILELHDNIMFYLFIILGLVSWLLFTIVRTYSKNPIAYKYI KHGQTIEIIWTIFPAVILLIIAFPSFILLYLCDEVISPAMTIKAIGLQWYWKYEYSDFIN DNGETVEFESYVIPEDLLEDGQLRLLDTDTSVVVPVDTHIRFVVTAADVIHDFAVPSLGI KIDAAPGRLNQVSALIQREGVFYGQCSEICGQSHSAMPIKIEAVSLPAFLEWLNEQ
Uniprot No.

Target Background

Function
Recombinant Kluyveromyces lactis Cytochrome c oxidase subunit 2 (COX2) is a component of cytochrome c oxidase (Complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain. This enzyme drives oxidative phosphorylation. The respiratory chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II, CII), ubiquinol-cytochrome c oxidoreductase (Complex III, CIII), and cytochrome c oxidase (Complex IV, CIV). These complexes work collaboratively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient powers transmembrane transport and ATP synthase. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CuA) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) consisting of heme A3 and copper B (CuB). The BNC reduces molecular oxygen to two water molecules using four electrons from cytochrome c in the IMS and four protons from the mitochondrial matrix.
Database Links
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the role of COX2 in mitochondrial function?

Cytochrome c oxidase subunit 2 (COX2) is a critical component of the mitochondrial respiratory chain. It functions as part of the cytochrome c oxidase complex, which plays a key role in cellular energy production. Experiments using mitochondrial Cox2 tagged at the C-terminus with an HA epitope have clearly demonstrated the specific involvement of assembly factors like Cox18 in the translocation of the Cox2 C-tail . This protein is essential for electron transfer and contributes to the proton-pumping function of the enzyme complex.

How does K. lactis COX2 differ from COX2 in other yeast species?

While COX2 serves similar fundamental roles across yeast species, K. lactis exhibits distinct characteristics related to its respiratory metabolism. Unlike Saccharomyces cerevisiae, K. lactis is Crabtree-negative and relies more heavily on respiratory metabolism. The evolutionary distance between K. lactis and S. cerevisiae is reflected in their genetic diversity, with K. lactis showing remarkably high genetic diversity (π = 2.8 × 10^-2, θw = 3.3 × 10^-2), almost 10-fold higher compared to S. cerevisiae (π = 3 × 10^-3) . This genetic divergence influences protein characteristics and potentially affects heterologous expression strategies.

What expression vectors are most suitable for recombinant COX2 production in K. lactis?

For recombinant protein expression in K. lactis, vectors containing the LAC4 promoter have shown superior performance. This promoter is activated by galactose or lactose, with galactose demonstrating stronger induction capabilities. Studies have shown that galactose increased transferase activity from 92 ± 23 to 166 ± 11 U/mL compared to lactose induction . Integration vectors that target stable chromosomal insertion are preferable for long-term expression, while episomal vectors may be useful for initial screening.

What are the genetic requirements for functional expression of recombinant COX2 in K. lactis?

Functional expression of recombinant COX2 requires consideration of several genetic factors:

  • Proper signal sequences for mitochondrial targeting

  • Codon optimization for K. lactis expression

  • Co-expression of assembly factors like Cox18, which has been shown to be required specifically for the accumulation of Cox2

  • Consideration of metal ion incorporation, particularly copper, which is essential for cytochrome c oxidase function

How do assembly factors influence recombinant COX2 production in K. lactis?

The assembly of functional COX2 requires dedicated factors, with Cox18 playing a crucial role. Biochemical analyses have suggested that the Neurospora crassa homolog of Cox18 interacts more stably than Oxa1 with Cox2 . For recombinant expression, these assembly factors may become rate-limiting. Research suggests that Cox18 was first identified in Kluyveromyces lactis as necessary for cytochrome c oxidase activity and later shown in both Saccharomyces cerevisiae and Neurospora crassa to be required specifically for the accumulation of Cox2 . Co-expression strategies incorporating these assembly factors could enhance proper folding and functional integration of recombinant COX2.

What role does oxidative stress play in recombinant COX2 expression in K. lactis?

Oxidative stress significantly impacts recombinant protein production in K. lactis. Studies have demonstrated that overexpression of the K. lactis SOD1 gene increased the production of heterologous proteins while simultaneously decreasing reactive oxygen species (ROS) that originated during protein production . For recombinant COX2, which functions in the electron transport chain, managing oxidative stress is particularly critical. Experimental evidence shows that heterologous protein yield in K. lactis increased in the presence of the antioxidant agent ascorbic acid and decreased when cells were challenged with menadione, a ROS generator compound .

How can researchers optimize post-translational modifications for recombinant COX2?

Post-translational modifications of recombinant COX2 in K. lactis require specific consideration:

Modification TypeOptimization StrategyResearch Consideration
Metal incorporationCopper supplementationEssential for enzyme activity
Membrane insertionCox18 co-expressionFacilitates C-terminal translocation
Disulfide bond formationOxidative environment controlBalance between formation and oxidative damage
Proteolytic processingProtease-deficient strainsMay improve yield of intact protein

SOD1 has been shown to function in copper loading, effectively inserting Cu^2+ into newly synthesized apoprotein and catalyzing the formation of essential disulfide bonds .

What are the differences in expression dynamics between chromosomally integrated versus episomal recombinant COX2 genes?

This comparison is crucial for experimental design planning:

ParameterChromosomal IntegrationEpisomal Expression
Expression stabilityHigher long-term stabilityVariable copy number
Copy number controlPredictable (single/multi-copy)Less predictable
Selection pressureCan be marker-free after integrationRequires continuous selection
Expression levelGenerally more moderatePotentially higher but variable
Scale-up consistencyMore reproducibleMay show batch variability

What are the optimal fermentation conditions for recombinant COX2 expression in K. lactis?

Fermentation optimization for K. lactis should focus on these parameters:

ParameterOptimal RangeEffect on Expression
Dissolved oxygen40-60%Critical for respiratory metabolism and functional COX2
Carbon sourceGlucose with galactose inductionMaximizes biomass while inducing expression
Induction ratioGalactose:glucose ratio of 0.45Increases transferase activity from 40 to 52 U/mL
Temperature28-30°CBalances growth and proper protein folding
pH5.5-6.5Affects secretion efficiency

Research has demonstrated that maintaining dissolved oxygen at 40-60% is critical for K. lactis cultures . Additionally, the timing of induction and the galactose:glucose ratio significantly impact protein expression levels.

How can researchers assess the functional integrity of recombinant COX2?

Multiple complementary approaches should be employed:

  • Spectrophotometric assays measuring cytochrome c oxidation rates

  • Oxygen consumption measurements using polarographic electrodes

  • Blue Native PAGE to assess complex assembly

  • Defined unit activity assays, where one unit of enzyme activity can be defined as the amount that inhibits the reduction of cytochrome c by 50% in a coupled system

  • Complementation assays in COX2-deficient strains to confirm biological activity

What purification strategies yield the highest purity and activity for recombinant COX2?

Effective purification strategies must address the membrane-bound nature of COX2:

  • Subcellular fractionation to isolate mitochondria

  • Solubilization using appropriate detergents (mild non-ionic detergents preserve activity)

  • Affinity chromatography (if tagged) or ion exchange chromatography

  • Size exclusion chromatography for final polishing

Throughout purification, maintaining an environment that preserves copper incorporation and proper folding is essential for retaining activity.

How can researchers address issues of misfolding or aggregation of recombinant COX2?

Strategies to mitigate misfolding and aggregation include:

  • Co-expression of molecular chaperones and assembly factors

  • Optimization of growth temperature (lower temperatures often reduce aggregation)

  • Use of fusion partners that enhance solubility

  • Supplementation with copper to ensure proper metalloprotein formation

  • Overexpression of antioxidant enzymes like SOD1, which has been shown to increase heterologous protein production in K. lactis

What are common bottlenecks in recombinant COX2 expression and how can they be overcome?

Key bottlenecks and solutions include:

BottleneckSolution StrategyResearch Evidence
Native enzyme competitionGeneration of knockout strainsK. lactis GG799ΔInv mutant reached higher CDW (101.1 ± 1.37 g/L) versus wild-type (57.8 ± 4.2 g/L)
Oxidative stressSOD1 overexpressionIncreased heterologous protein production while decreasing ROS
Inefficient copper loadingCCS1 co-expressionCCS1 codes for copper chaperone necessary for SOD1 function
Glucose repressionFeed control strategiesNative K. lactis invertase gene is repressed by glucose

Research has demonstrated that the K. lactis GG799ΔInv mutant (with inactive invertase) showed improved transferase activity of 557.0 ± 36.2 U/mL compared to 414.7 ± 11.7 U/mL for the production strain .

How can researchers distinguish between expression, folding, and assembly issues?

Distinguishing between different production bottlenecks requires specific analytical approaches:

  • Expression issues:

    • Western blotting to detect total protein regardless of folding state

    • qRT-PCR to assess mRNA levels

    • Pulse-chase experiments to track protein synthesis

  • Folding problems:

    • Detergent solubility profiles (properly folded membrane proteins exhibit characteristic solubility)

    • Limited proteolysis (misfolded proteins show altered digestion patterns)

    • Spectroscopic methods to assess structural integrity

  • Assembly defects:

    • BN-PAGE to visualize complex formation

    • Activity assays (assembly defects often preserve protein but reduce activity)

    • Co-immunoprecipitation to detect interactions with other subunits

What genetic engineering approaches show promise for improving recombinant COX2 production?

Advanced genetic approaches include:

  • CRISPR/Cas9 modification of K. lactis to:

    • Remove competing pathways (such as invertase, which has been shown to improve yields when deleted)

    • Enhance expression of Cox18 and other assembly factors

    • Integrate anti-oxidative stress elements

  • Promoter engineering to create:

    • Stronger inducible expression systems

    • Finer regulation of expression timing

    • Reduced glucose repression effects

How might multi-omics approaches advance our understanding of recombinant COX2 expression?

Integration of multiple omics technologies can provide insights into:

  • Transcriptomic analysis to identify:

    • Rate-limiting steps in the expression pathway

    • Stress responses triggered by recombinant expression

    • Potential co-regulated genes for coordinated expression

  • Proteomic analysis to monitor:

    • Post-translational modifications

    • Protein-protein interactions affecting assembly

    • Cellular responses to expression burden

  • Metabolomic analysis to optimize:

    • Carbon source utilization

    • Metal ion homeostasis

    • Redox balance during expression

These approaches, combined with the genetic diversity observed in K. lactis (θw = 3.3 × 10^-2) , provide rich opportunities for strain optimization and expression improvement.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.