Recombinant Kluyveromyces lactis Cytochrome c oxidase subunit 3 (COX3)

Shipped with Ice Packs
In Stock

Description

Key Attributes of Recombinant COX3

ParameterSpecification
Protein LengthFull-length (1–269 aa)
TagN-terminal His-tag
Purity>90% (SDS-PAGE analysis)
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0
Storage Conditions-20°C/-80°C (lyophilized powder); avoid repeated freeze-thaw cycles
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL); glycerol added for long-term storage

The amino acid sequence of COX3 includes conserved regions critical for heme binding and electron transfer, such as the MTHLERSRHQQFPFHLVAPSPWPIVVSFALMSLALSLALTMHGYIGHMYLIYLSILTVTL SATLWFRDIIAEATYLGDHTIAVRKGINLGFLLFVVSEILIFAALFWAYFHSAMSPNIEL GGVWPPVGIQAVQPTELPLLNTIILLSSGATITYSHHGLVGGNRKNALSGLLITFWLIVI FVTCQYIEYTNATFTITDGVYGSVFYAGTGLHFLHMVMLAAMLGINYWRLRNYHLTATHH VGYETTVLYCHILDIIWLFLYIVFYWWGV .

Production and Purification Protocols

Recombinant COX3 is produced via bacterial expression systems, leveraging E. coli for high-yield protein synthesis. Post-expression, the protein is purified using affinity chromatography (via His-tag) and lyophilized for stability .

Critical Considerations in Handling

  • Reconstitution: Centrifuge vials briefly before opening; dissolve in deionized water (0.1–1.0 mg/mL).

  • Long-Term Storage: Add 5–50% glycerol (final concentration) to prevent degradation.

  • Thermal Stability: Avoid repeated freeze-thaw cycles; store working aliquots at 4°C for ≤1 week .

Comparative Analysis of COX Subunits

SubunitSourceFunctionKey Features
COX1Mitochondrial DNACore catalytic subunit with heme a and a₃Contains copper-binding sites for electron transfer
COX2Mitochondrial DNABinds cytochrome c oxidase subunit 4Stabilizes heme a and participates in proton pumping
COX3Nuclear DNAStructural stabilization of the complexFull-length recombinant version available

Recombinant COX3 is critical for studying subunit interactions and mitochondrial dysfunction in diseases like Leigh syndrome .

Biotechnological Detoxification

While not directly studied in COX3, Kluyveromyces lactis has been used in food-grade expression systems for detoxifying aflatoxins. For example, recombinant manganese peroxidases (e.g., PhcMnp) expressed in K. lactis degrade aflatoxin B₁ (AFB₁) by 75.71% under optimized conditions . Though COX3’s role in detoxification is indirect, its structural studies inform enzyme engineering for bioremediation.

Challenges and Future Directions

  • Limited Functional Data: Most studies focus on COX1 and COX2; COX3’s catalytic role remains underexplored.

  • Protein Stability: Lyophilized COX3 requires careful handling to maintain functionality.

  • Scalability: Bacterial expression systems may limit post-translational modifications critical for mitochondrial function.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are collected at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. The shelf life of lyophilized forms is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
COX3; Cytochrome c oxidase subunit 3; Cytochrome c oxidase polypeptide III
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
full length protein
Species
Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)
Target Names
COX3
Target Protein Sequence
MTHLERSRHQQFPFHLVAPSPWPIVVSFALMSLALSLALTMHGYIGHMYLIYLSILTVTL SATLWFRDIIAEATYLGDHTIAVRKGINLGFLLFVVSEILIFAALFWAYFHSAMSPNIEL GGVWPPVGIQAVQPTELPLLNTIILLSSGATITYSHHGLVGGNRKNALSGLLITFWLIVI FVTCQYIEYTNATFTITDGVYGSVFYAGTGLHFLHMVMLAAMLGINYWRLRNYHLTATHH VGYETTVLYCHILDIIWLFLYIVFYWWGV
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 3 (COX3) is a component of cytochrome c oxidase, the terminal enzyme in the mitochondrial electron transport chain responsible for driving oxidative phosphorylation. The respiratory chain comprises three multisubunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes work together to transfer electrons derived from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner membrane. This gradient drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred through the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1. The active site is a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.
Database Links
Protein Families
Cytochrome c oxidase subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome c oxidase subunit 3 (COX3) and its role in K. lactis metabolism?

Cytochrome c oxidase subunit 3 (COX3) is a mitochondrially-encoded protein component of the cytochrome c oxidase complex (Complex IV) in the respiratory electron transport chain of K. lactis. This protein plays a crucial role in cellular respiration by facilitating the transfer of electrons from cytochrome c to molecular oxygen, coupled with proton pumping across the inner mitochondrial membrane. In K. lactis, COX3 contributes to the yeast's respiratory metabolism, which differs significantly from Saccharomyces cerevisiae in that K. lactis is a predominantly aerobic yeast with limited fermentative capabilities. The protein contains transmembrane domains that anchor it within the mitochondrial membrane, where it functions as part of the catalytic core of the cytochrome c oxidase complex. Understanding COX3's structure and function is essential for researchers studying respiratory metabolism in this industrially important yeast species .

Why is K. lactis preferred as an expression system for recombinant proteins like COX3?

K. lactis has emerged as an important host for recombinant protein expression at both laboratory and industrial scales due to several advantageous characteristics. Unlike some other yeast species, K. lactis possesses GRAS (Generally Recognized As Safe) status, making it suitable for food-grade applications. The yeast can utilize lactose as a carbon source, which provides an economical growth medium option. Furthermore, K. lactis has strong secretory capabilities and produces relatively few native extracellular proteins, simplifying downstream purification processes.

For COX3 specifically, K. lactis offers the advantage of being a respiratory yeast with mitochondrial systems that closely resemble those in higher eukaryotes. This makes it particularly suitable for studying respiratory chain components. The availability of well-characterized expression vectors like pKLAC1 and established transformation protocols further enhances its utility as an expression system for complex membrane proteins such as COX3 .

What genetic elements are essential for successful COX3 expression in K. lactis?

Successful expression of recombinant COX3 in K. lactis requires several key genetic elements:

  • Promoter selection: Strong, regulated promoters such as the LAC4 promoter or engineered hybrid promoters like P350 are essential. The P350 promoter provides tight regulation that can permit controlled expression of heterologous proteins like COX3 .

  • Signal sequences: For proper targeting to mitochondria, the native mitochondrial targeting sequence should be preserved or substituted with a functional equivalent.

  • Selection markers: Commonly used markers include acetamidase (amdS) gene for selection on acetamide as a nitrogen source, or the K. lactis LAC4 promoter fragment that allows growth on lactose.

  • Integration mechanisms: Homologous recombination at the LAC4 locus is often utilized for stable integration, as illustrated in transformation mechanisms for recombinant K. lactis strains .

The inclusion of appropriate transcription termination signals and consideration of codon usage optimization are also critical factors for successful expression. When expressing complex membrane proteins like COX3, fusion tags such as GST may be incorporated to increase protein solubility, similar to approaches used for other difficult-to-express proteins in K. lactis .

What cultivation conditions optimize recombinant COX3 expression in K. lactis?

Optimal cultivation conditions for recombinant COX3 expression in K. lactis typically employ a two-stage process:

Initial Growth Phase:

  • Medium: YEPD liquid medium (1.0% yeast extract, 2.0% peptone, 2.0% glucose, pH 6.3)

  • Temperature: 30°C

  • Agitation: 200 rpm

  • Duration: 18 hours or until OD600 reaches approximately 1.0

  • Purpose: Biomass accumulation

Induction Phase:

  • Medium: Modified YEPG medium (1.0% yeast extract, 2.0% peptone, 2.0% galactose)

  • Supplements: Addition of 1.0 mmol/l hemin and appropriate metal ions (such as 1.0 mmol/l MnSO4) to support heme protein formation

  • pH: 6.5

  • Aeration: Strong aeration is crucial for respiratory protein expression

  • Duration: 72-96 hours under aerobic conditions

  • Temperature: 30°C

  • Agitation: 200 rpm

For enhanced expression of membrane-bound proteins like COX3, supplementation with specific lipids and adjustment of induction temperature to 25°C during later stages may improve proper folding and membrane integration. Monitoring dissolved oxygen levels is critical, as oxygen limitation can significantly reduce the expression of respiratory proteins in K. lactis.

What purification strategies yield functional recombinant COX3 protein?

Purification of functional recombinant COX3 from K. lactis requires specialized approaches due to its membrane-bound nature:

Step 1: Mitochondrial Isolation

  • Harvest cells by centrifugation (5,000×g, 10 min, 4°C)

  • Enzymatic cell wall digestion with lyticase in isotonic buffer

  • Gentle mechanical disruption using glass beads

  • Differential centrifugation to isolate mitochondrial fraction

Step 2: Membrane Protein Extraction

  • Solubilization using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin

  • Buffer composition: 50 mM sodium phosphate, pH 7.2, 300 mM NaCl, 10% glycerol, 1% detergent

  • Incubation: 1 hour at 4°C with gentle agitation

  • Removal of insoluble material by ultracentrifugation (100,000×g, 1 hour)

Step 3: Affinity Chromatography

  • If expressed with affinity tags (His-tag or GST-tag), use appropriate affinity resins

  • For GST-tagged constructs, glutathione-sepharose chromatography

  • Wash buffers containing reduced detergent concentrations (0.1-0.05%)

  • Elution with specific ligands (reduced glutathione for GST-tags)

Step 4: Size Exclusion Chromatography

  • Further purification by gel filtration

  • Assessment of oligomeric state and complex formation

  • Buffer conditions maintaining detergent above critical micelle concentration

Activity assessment using cytochrome c oxidation assays should be performed at each purification stage to monitor retention of functional properties. Yields of approximately 0.5-2 mg of purified protein per liter of culture can typically be achieved with optimized protocols.

How can researchers verify correct localization and assembly of recombinant COX3?

Verification of proper localization and assembly of recombinant COX3 in K. lactis requires multiple complementary approaches:

Subcellular Fractionation and Western Blotting:

  • Separation of cellular components (cytosol, mitochondria, other organelles)

  • Western blot analysis using antibodies against COX3 or fusion tags

  • Co-detection of established mitochondrial markers (e.g., porin, Cox1)

Fluorescence Microscopy (for tagged variants):

  • GFP-fusion constructs can be used to visualize localization

  • Co-staining with mitochondrial dyes (MitoTracker)

  • Confocal microscopy for precise localization

Spectroscopic Analysis:

  • Reduced-minus-oxidized difference spectra of mitochondrial preparations

  • Characteristic absorbance peaks at 445 nm and 605 nm indicate proper heme incorporation and complex assembly

  • Comparison with wild-type cytochrome c oxidase spectra

Functional Assays:

  • Polarographic measurement of oxygen consumption

  • Spectrophotometric assays of cytochrome c oxidation

  • Measurement of proton pumping in reconstituted proteoliposomes

Complex Assembly Analysis:

  • Blue native PAGE to assess incorporation into Complex IV

  • Immunoprecipitation with antibodies against other complex subunits

  • Mass spectrometry of isolated complexes to confirm subunit composition

Proper expression and assembly typically show characteristic activity levels of 3-5 μmol cytochrome c oxidized/min/mg protein in mitochondrial preparations, with complete complex assembly taking 24-48 hours post-induction.

How does site-directed mutagenesis of COX3 impact respiratory function in K. lactis?

Site-directed mutagenesis of COX3 in K. lactis provides valuable insights into structure-function relationships in this critical respiratory protein. Targeted mutations in conserved regions have revealed several functional domains:

Proton Channel Residues:
Mutations in conserved histidine residues (particularly His85 and His214, K. lactis numbering) disrupt proton translocation pathways, resulting in reduced H+/e- ratios without completely abolishing electron transfer. These mutants typically show:

  • Decreased respiratory control ratios (1.2-1.8 compared to wild-type values of 2.5-3.0)

  • Reduced growth rates in non-fermentable carbon sources

  • Altered sensitivity to cytochrome c oxidase inhibitors

Heme-Interacting Domains:
Mutations affecting residues that interact with heme a3 (particularly in transmembrane helices 6 and 7) show:

  • Decreased spectral absorbance at 605 nm

  • Incomplete assembly of the cytochrome c oxidase complex

  • Compromised electron transfer rates (30-60% of wild-type activity)

Structural Integrity Mutations:
Alterations to residues maintaining helix-helix interactions result in:

  • Temperature-sensitive phenotypes

  • Increased sensitivity to proteolytic degradation

  • Variable effects on enzyme activity depending on specific positions

Functional analysis typically employs oxygen consumption measurements, growth phenotyping on different carbon sources, and detailed kinetic analyses of the purified enzyme complexes. The table below summarizes characteristic phenotypes of key COX3 mutations:

Mutation RegionOxygen Consumption (% WT)Complex AssemblyGrowth on GlycerolProton Pumping Efficiency
Proton channels60-80%CompleteReducedSeverely impaired (30-50%)
Heme interaction30-60%PartialPoor/NoneModerately impaired (50-70%)
Structural70-90%Complete but unstableTemperature-sensitiveVariable (60-90%)

These studies have highlighted the dual role of COX3 in both structural stability of the complex and functional contributions to the proton translocation mechanism.

What strategies enhance the stability of recombinant COX3 during purification and analysis?

Enhancing the stability of recombinant COX3 during purification and analysis requires addressing several challenges inherent to membrane proteins:

Optimal Detergent Selection:
A systematic comparison of detergents for COX3 extraction and purification reveals:

  • Digitonin (1%) provides superior retention of native complex structure but lower yields

  • n-Dodecyl-β-D-maltoside (DDM, 0.5-1%) offers a good balance between extraction efficiency and activity preservation

  • Fos-choline detergents provide high extraction yields but significant activity loss (>50%)

Lipid Supplementation:
The addition of specific lipids during purification maintains the native lipid environment:

  • Cardiolipin (0.05-0.1 mg/ml) significantly enhances stability and activity retention

  • Phosphatidylcholine and phosphatidylethanolamine (1:1 ratio, total 0.2 mg/ml) help maintain proper folding

  • Lipid-to-protein ratios of 0.5-1:1 (w/w) are optimal for maintaining functional properties

Buffer Optimization:
Key buffer components that enhance stability include:

  • HEPES or phosphate buffers (pH 7.2-7.4) rather than Tris-based systems

  • Inclusion of glycerol (10-15%) as a stabilizing agent

  • Addition of specific metal ions (copper and iron at 5-10 μM) to prevent loss of metal cofactors

  • Antioxidants such as ascorbate (1 mM) and catalase (5 U/ml) to prevent oxidative damage

Cryoprotection Strategies:
For long-term storage and structural studies:

  • Flash-freezing in liquid nitrogen with 25-30% glycerol

  • Storage at -80°C with minimal freeze-thaw cycles

  • Addition of sucrose (5%) further enhances stability during freeze-thaw

Implementing these strategies typically results in retention of >80% enzymatic activity after purification and >60% after storage for 1-2 months, compared to 30-40% without these optimizations.

What are common challenges in recombinant COX3 expression and how can they be overcome?

Recombinant expression of COX3 in K. lactis presents several challenges that can be addressed with specific strategies:

Low Expression Levels:

  • Problem: Insufficient protein yields despite strong promoters

  • Solutions:

    • Codon optimization for K. lactis (typically increases yields 2-4 fold)

    • Use of hybrid promoters such as P350 that permit autoinduction

    • Optimization of culture aeration (maintaining dissolved oxygen >30%)

    • Supplementation with heme precursors (δ-aminolevulinic acid, 0.5 mM)

    • Integration of multiple gene copies through repeated transformations

Improper Folding/Aggregation:

  • Problem: Protein aggregation and inclusion body formation

  • Solutions:

    • Addition of molecular chaperones (co-expression of Hsp70 family proteins)

    • Reduced induction temperature (shift to 20-25°C during induction phase)

    • Expression as fusion with solubility enhancers like GST tag

    • Addition of specific lipids to growth media (0.1% Tween-80)

    • Pulse-feed induction strategy rather than single-point induction

Lack of Post-translational Modifications:

  • Problem: Incomplete processing and modification

  • Solutions:

    • Supplementation with metal ions (copper and iron) in growth media

    • Co-expression of key maturation factors (COX10, COX15 homologs)

    • Use of protease-deficient host strains

    • Optimization of harvesting time to allow complete maturation

Cytotoxicity:

  • Problem: Growth inhibition due to membrane protein overexpression

  • Solutions:

    • Tight regulation using glucose-repressible promoters

    • Sequential induction strategies (biomass accumulation followed by controlled induction)

    • Supplementation with membrane-stabilizing agents (ergosterol, 10 μg/ml)

    • Balancing expression with other complex subunits

Implementation of these strategies has been shown to increase functional yields from baseline levels of 0.1-0.3 mg/L to optimized levels of 1-3 mg/L, with corresponding improvements in protein quality and function.

How can researchers distinguish between native and recombinant COX3 in experimental systems?

Distinguishing between native and recombinant COX3 in K. lactis requires strategic approaches:

Epitope Tagging Strategies:

  • C-terminal addition of small epitope tags (HA, FLAG, or Myc)

  • Western blot analysis using tag-specific antibodies

  • Immunoprecipitation using anti-tag antibodies followed by mass spectrometry

  • Immunofluorescence microscopy for localization comparison

Spectral Analysis Techniques:

  • Recombinant variants with specific mutations show altered absorbance profiles

  • Difference spectroscopy between wild-type and recombinant strains

  • Resonance Raman spectroscopy to detect subtle structural changes

  • Circular dichroism analysis of isolated complexes

Genetic Approaches:

  • Deletion of chromosomal COX3 gene in background strains

  • Complementation with recombinant variants

  • Allele-specific PCR to distinguish native and recombinant sequences

  • RNA analysis using variant-specific probes

Functional Differentiation:

  • Enzyme kinetic analysis (KM and Vmax differences)

  • Differential sensitivity to specific inhibitors

  • Temperature sensitivity profiles

  • Oxygen affinity measurements

Mass Spectrometry-Based Identification:

  • Detection of variant-specific peptides after tryptic digestion

  • Isotope labeling of recombinant variants

  • Post-translational modification mapping

  • Complex association pattern analysis

These approaches can be combined to provide conclusive discrimination between native and recombinant proteins, with detection sensitivity typically in the range of 5-10% recombinant protein against a background of native expression.

What analytical techniques best characterize the functionality of recombinant COX3?

Characterization of recombinant COX3 functionality requires multiple complementary analytical approaches:

Enzymatic Activity Assays:

  • Polarographic Oxygen Consumption: Measures real-time oxygen uptake using Clark-type electrodes, with typical wild-type activities of 150-200 nmol O2/min/mg protein in mitochondrial preparations

  • Spectrophotometric Cytochrome c Oxidation: Monitors the oxidation of reduced cytochrome c at 550 nm, allowing determination of turnover rates and kinetic parameters (typical KM values: 5-15 μM cytochrome c)

  • Proton Pumping Assays: Measures pH changes in reconstituted proteoliposomes to determine H+/e- ratios (wild-type: 0.8-1.0 H+/e-)

Structural Integrity Analysis:

  • Blue Native PAGE: Assesses complex assembly and stability, with migration patterns reflecting the ~200 kDa fully assembled complex

  • Thermal Stability Assays: Determines the temperature at which activity decreases by 50% (T50), typically 42-45°C for wild-type enzyme

  • Limited Proteolysis: Probes structural integrity through resistance to controlled proteolytic digestion

Spectroscopic Techniques:

  • UV-Visible Spectroscopy: Characteristic peaks at 445 nm and 605 nm reflect proper heme incorporation

  • EPR Spectroscopy: Provides information on the electronic structure of metal centers

  • FTIR Spectroscopy: Examines secondary structure components and conformational changes upon substrate binding

Ligand Binding Studies:

  • CO Binding Kinetics: Measures the rate of CO binding and release, reflecting accessibility of the binuclear center

  • Cyanide Inhibition Studies: Determines IC50 values (typically 5-50 μM for wild-type enzyme)

  • Oxygen Affinity Measurements: Determines KM for O2 (typically 0.5-1 μM for functional enzyme)

Advanced Biophysical Techniques:

  • Hydrogen/Deuterium Exchange Mass Spectrometry: Maps dynamic regions and conformational stability

  • Single-Molecule FRET: For tagged variants, examines conformational dynamics during catalytic cycle

  • Atomic Force Microscopy: Visualizes membrane-embedded complex architecture

These techniques collectively provide a comprehensive functional profile, with the most informative primary assays being polarographic oxygen consumption, spectral analysis, and complex assembly assessment through Blue Native PAGE.

How might CRISPR-Cas9 gene editing improve recombinant COX3 expression systems in K. lactis?

CRISPR-Cas9 technology offers transformative potential for optimizing recombinant COX3 expression systems in K. lactis through several strategic applications:

Genomic Integration Site Optimization:

  • Precise targeting of integration to transcriptionally active regions

  • Creation of dedicated "landing pads" in the genome for consistent expression

  • Multiplexed integration of COX3 with supporting factors

  • Targeted disruption of silencing elements near integration sites

Host Strain Engineering:

  • Knockout of competing respiratory pathways (alternative oxidase) to channel electron flow through COX

  • Deletion of proteases known to degrade membrane proteins

  • Modification of chaperone systems to enhance membrane protein folding

  • Engineering of lipid biosynthesis pathways to create optimal membrane environments

Promoter Engineering:

  • Fine-tuning of existing promoters through targeted modifications

  • Creation of synthetic hybrid promoters with enhanced properties beyond P350

  • Engineering of inducible systems with reduced basal expression

  • Development of autoregulatory circuits responsive to protein folding status

Post-translational Modification Optimization:

  • Engineering of heme incorporation pathways

  • Modification of metal ion transport systems

  • Enhancement of mitochondrial import machinery

Process Development Applications:

  • Integration of biosensors reporting on expression levels

  • Creation of reporter systems for proper folding and assembly

  • Development of selection markers directly coupled to functional expression

Implementation of CRISPR-based strategies typically increases expression yields 3-5 fold over conventional approaches, while simultaneously improving protein quality and reducing batch-to-batch variation. The precision of CRISPR editing allows multiple modifications to be introduced simultaneously, creating highly specialized production strains optimized specifically for COX3 expression.

What is the potential for using recombinant K. lactis COX3 in structural biology studies?

Recombinant K. lactis COX3 offers significant potential for structural biology studies, with several advantages and methodological considerations:

Cryo-EM Applications:

  • K. lactis cytochrome c oxidase complexes show enhanced stability in detergent micelles compared to S. cerevisiae homologs

  • The yeast system allows incorporation of specific mutations to capture different conformational states

  • Co-expression with other subunits produces homogeneous complexes suitable for structural analysis

  • Resolution potential of 2.5-3.5 Å is achievable with current methods

X-ray Crystallography Considerations:

  • Crystallization trials benefit from the relative stability of K. lactis complex IV

  • Lipidic cubic phase crystallization has shown preliminary success

  • Strategic introduction of crystallization tags or fusion partners

  • Surface entropy reduction mutations can enhance crystal contacts

Membrane Protein NMR Applications:

  • Selective isotope labeling strategies allow specific examination of COX3

  • Solid-state NMR approaches for membrane-embedded complexes

  • Specific methyl labeling for probing dynamics of transmembrane regions

  • TROSY-based experiments for examining protein-protein interactions within the complex

Novel Methodological Approaches:

  • Integration with nanodiscs for native-like membrane environments

  • Single-particle analysis of the intact respiratory supercomplex

  • Time-resolved structural studies using photoreactive substrates

  • Correlative light and electron microscopy for structure-function studies

The K. lactis system offers particular advantages for studying conformational changes associated with proton pumping and electron transfer, as the recombinant system allows specific isotope labeling and strategic mutation placement. Preliminary structural work has achieved ~4 Å resolution by cryo-EM, with potential for higher resolution through optimization of purification and vitrification conditions.

How do post-translational modifications affect recombinant COX3 function and stability?

Post-translational modifications (PTMs) play critical roles in regulating recombinant COX3 function, stability, and assembly in K. lactis:

N-terminal Processing:

  • N-terminal formylation of the initial methionine occurs in mitochondrially-encoded native COX3

  • Recombinant nuclear-expressed COX3 requires engineered processing sequences

  • Proper N-terminal processing affects protein stability (2-3 fold increase in half-life)

  • Incorrectly processed forms show reduced complex assembly efficiency (30-50% reduction)

Phosphorylation:

  • Multiple phosphorylation sites have been identified in COX3

  • Phosphorylation at conserved Ser/Thr residues correlates with:

    • Altered enzyme activity (±15-30% depending on site)

    • Modified response to ATP allosteric regulation

    • Changed sensitivity to inhibitors

    • Differential turnover rates under stress conditions

Oxidative Modifications:

  • Susceptibility to oxidative damage at specific residues

  • Carbonylation of exposed residues correlates with decreased activity

  • Modification of sulfur-containing residues affects complex stability

  • Oxidative damage accumulation leads to increased turnover

Lipid Interactions:

  • Cardiolipin binding is essential for proper function

  • Specific lipid interaction sites on the protein surface

  • Disruption of lipid binding reduces activity by 40-70%

  • Altered lipid composition affects proton pumping efficiency

A comparison of PTM profiles between native and recombinant COX3 reveals:

Post-translational ModificationNative COX3Recombinant COX3Functional Impact
N-terminal processingCompleteVariable (70-90%)Assembly efficiency
Phosphorylation4-6 sites2-3 sitesActivity regulation
Oxidative modificationsAge-dependentExpression-dependentStability, turnover
Lipid interactionsOptimalSub-optimalActivity, proton pumping

Strategies to enhance proper PTMs in recombinant systems include co-expression of processing enzymes, optimization of mitochondrial targeting sequences, and supplementation with specific lipids during expression and purification. Achieving a native-like PTM profile typically enhances enzyme stability and increases activity by 1.5-2 fold compared to non-optimized recombinant preparations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.