Recombinant Kluyveromyces lactis Dol-P-Man:Man (5)GlcNAc (2)-PP-Dol alpha-1,3-mannosyltransferase (ALG3)

Shipped with Ice Packs
In Stock

Description

Biochemical Function and Mechanism

ALG3 is an ER-localized α-1,3-mannosyltransferase (EC 2.4.1.258) essential for the biosynthesis of N-glycans. Its activity ensures the elongation of the LLO precursor from Man5_5GlcNAc2_2-PP-Dol to Man6_6GlcNAc2_2-PP-Dol, a precursor for complex glycan structures . Deletion of ALG3 (Δalg3) in yeast such as K. lactis or K. marxianus results in truncated LLOs (Man5_5GlcNAc2_2), which are transferred to nascent glycoproteins, enabling the production of humanized glycoforms .

Key Reaction:

Dol-P-Man+Man5GlcNAc2-PP-DolALG3Man6GlcNAc2-PP-Dol+Dol-P\text{Dol-P-Man} + \text{Man}_5\text{GlcNAc}_2\text{-PP-Dol} \xrightarrow{\text{ALG3}} \text{Man}_6\text{GlcNAc}_2\text{-PP-Dol} + \text{Dol-P}

Applications in Glycoengineering

ALG3 deletion is a cornerstone strategy for humanizing yeast glycosylation. By halting hypermannosylation, strains produce Man5_5GlcNAc2_2-tagged glycoproteins, which serve as substrates for mammalian glycosyltransferases like GnT-I/II .

Case Study in K. marxianus:

  • Strain Engineering:

    • Δalg3 combined with Δoch1 (α-1,6-mannosyltransferase knockout) reduced mannose residues from >7 to Man5_5GlcNAc2_2 .

    • Co-expression of MdsI (α-1,2-mannosidase) and GnTII further trimmed glycans to Man3_3GlcNAc2_2 and GlcNAc2_2Man3_3GlcNAc2_2 .

Glycan Profile Shifts Post-ALG3 Knockout:

StrainMajor N-GlycanProportion ChangeReference
Wild-type K. marxianusMan814_{8-14}GlcNAc2_2Baseline
Δalg3/Δoch1Man5_5GlcNAc2_2+48% (vs. wild-type)
Δalg3/Δoch1 + MdsIMan3_3GlcNAc2_2Up to 2.88% yield

Challenges and Optimizations

  • Low Efficiency: Recombinant ALG3 activity in vitro is limited by Dol-P-Man availability and ER membrane integration .

  • Strain Viability: Δalg3 mutants show reduced protein secretion due to inefficient LLO glucosylation, addressed via overexpression of glucosyltransferases .

  • Promoter Compatibility: Simultaneous expression of MdsI and GnTII under the LAC4 promoter in K. marxianus led to suboptimal enzyme levels, resolved by removing competing Cas9 genes .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time estimates.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. For multiple use, aliquoting is recommended to minimize freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please communicate it to us, and we will prioritize developing it.
Synonyms
ALG3; KLLA0E20823g; Dol-P-Man:Man(5GlcNAc(2-PP-Dol alpha-1,3-mannosyltransferase; Asparagine-linked glycosylation protein 6; Dol-P-Man-dependent alpha(1-3-mannosyltransferase; Dolichyl-P-Man:Man(5GlcNAc(2-PP-dolichyl mannosyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-462
Protein Length
full length protein
Species
Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)
Target Names
ALG3
Target Protein Sequence
MVEEGANKTVGAPTVGDDQQPKEFVRPPFTPFQDILDAFNYLMWNPEANAIAMPVLILLE SIAMKFIQNKVSYTEIDYTAYMEQIWMIQNGERDYSQIKGGTGPLVYPAGHVFIYKIFEW VSDGLENISEAQDLFRYLYVITLMIQFMCFGLLNIPPGYAIFAILSKRLHSVYVLRLFND CFTTLFMSLAVLVMILCAKYKIRGFLVLIGSSFYSMAVSIKMNALLYLPGVLLTIYLLER CNTFKIVLNLAVMVIWQVIIAIPFWKEYPWEYLQSAFNFSRQFMYKWSVNWQMVDEEVFL DPLFHRSLLISHVIVLVVFLFYKLIPTNMNTPAGLLKIGKANLLHPFTDAVFSAMRVNAE QIAYILLVTNYIGVLFARSLHYQFLSWYHWTLPVLLNWANVPYPLCVLWYLTHEWCWNSY PPNATASTLLHACNTSLLLAVFLRGPANSKSGDNETTHEKAE
Uniprot No.

Target Background

Function
This enzyme catalyzes the addition of the first Dol-P-Man derived mannose in an alpha-1,3 linkage to Man(5)GlcNAc(2)-PP-Dol.
Database Links
Protein Families
ALG3 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What are the advantages of using Kluyveromyces lactis as an expression system for glycosylation enzymes like ALG3?

Kluyveromyces lactis offers several advantages as an expression system for glycosylation enzymes such as ALG3 mannosyltransferase. This yeast strain can properly fold complex eukaryotic proteins and perform post-translational modifications similar to higher eukaryotes. K. lactis can grow to high cell densities, secrete proteins efficiently, and utilize various carbon sources. Unlike some other yeast systems, K. lactis exhibits reduced hyperglycosylation of recombinant proteins, making it particularly suitable for expressing glycosylation enzymes . Additionally, K. lactis strains are generally recognized as safe (GRAS) organisms, facilitating regulatory approval for products.

Which K. lactis strains are most suitable for recombinant ALG3 expression?

Based on research with other recombinant proteins, several K. lactis strains have demonstrated superior performance in heterologous protein expression. Strain selection significantly impacts expression levels, with differences of up to 100-fold observed between strains . For glycosylation enzymes like ALG3, the following strains are particularly promising:

StrainGenotypeNotable FeaturesRecommendation for ALG3 Expression
MW98-8CMAT α lysA argA ura3 rag1 HGT1 rag2Superior producer in multiple studies; best specific activityHighly recommended
MW270-7BMAT a metA leu2 ura3 RAG1 HGT1Good expression levelsRecommended
JA6MAT α ade1-600 adeT-600 trp1 ura3 KHT1 KHT2"Crabtree-positive" strainSuitable for specific applications
HF1987MAT a metA ura3 RAG1 HGT1Newer strain with good stabilityWorth testing

What promoter systems are most effective for expressing recombinant ALG3 in K. lactis?

The choice of promoter significantly influences expression levels and regulation patterns. For ALG3 expression in K. lactis, several promoter options exist:

  • KlPDC1 promoter: The pyruvate decarboxylase promoter provides strong expression regulated by carbon source and oxygen levels . This promoter is particularly effective for heterologous protein expression in K. lactis and has been successfully used with various recombinant proteins.

  • KILAC4 promoter: Inducible by lactose, offering controlled expression.

  • Constitutive promoters (e.g., PGK, ADH): Provide continuous expression without induction requirements.

For glycosylation enzymes like ALG3, the KlPDC1 promoter often provides an optimal balance of strong expression and regulatory control .

How should researchers optimize transformation protocols for integrating the ALG3 gene into K. lactis?

Successful integration of the ALG3 gene requires careful optimization of transformation protocols. Based on research with other recombinant proteins in K. lactis, the following methodological approach is recommended:

  • Vector design considerations:

    • Construct an expression cassette containing the ALG3 gene under the control of the KlPDC1 promoter

    • Include appropriate terminator sequences (e.g., S. cerevisiae PHO5 terminator)

    • Incorporate selection markers (e.g., URA3) for transformant screening

  • Transformation methods:

    • Frozen cell transformation protocol with PEG/lithium acetate

    • Electroporation for higher transformation efficiency

  • Integration strategies:

    • Random integration: Simple but may affect regulatory or essential genes

    • Targeted homologous recombination: More precise but lower efficiency in K. lactis

    • Sequential transformation for multiple gene copies

  • Verification of integration:

    • PCR verification with primers specific to the integration locus

    • Stability testing through repeated subculturing

    • Functional assays to confirm ALG3 activity

Integrative transformants generally provide more stable expression compared to replicative transformants, with specific activity approximately 3-5 fold higher in integrated versus replicative systems .

What culture conditions maximize recombinant ALG3 expression in K. lactis?

Culture conditions significantly impact the expression levels of recombinant ALG3 in K. lactis. The following parameters should be optimized:

ParameterRecommended ConditionsImpact on ALG3 Expression
Medium compositionYPD (rich) or SDA (defined)Rich media generally yields higher biomass; defined media offers better reproducibility
Carbon source2-5% glucoseAffects KlPDC1 promoter activity and metabolic state
Temperature28-30°COptimal for K. lactis growth and protein folding
pH5.5-7.0Affects secretion efficiency and enzyme stability
Aeration1.0-1.5 vvmCritical for optimal expression using KlPDC1 promoter
Cultivation time72-96 hoursMaximum expression typically occurs in late exponential/early stationary phase

For recombinant glycosylation enzymes, expression peaks are typically observed at 72-96 hours post-inoculation in batch cultures when using the KlPDC1 promoter system .

How can researchers verify the correct folding and activity of recombinant ALG3 expressed in K. lactis?

Verifying proper folding and activity of recombinant ALG3 is essential for ensuring experimental validity. The following methods are recommended:

  • In vitro enzymatic assay:

    • Prepare microsomal fractions from transformed K. lactis

    • Measure transfer of mannose from Dol-P-Man to the Man₅GlcNAc₂-PP-Dol substrate

    • Quantify reaction products by HPLC or mass spectrometry

  • Complementation testing:

    • Transform ALG3-deficient yeast strains with the recombinant construct

    • Verify restoration of normal N-glycosylation patterns

  • Protein characterization:

    • Western blot analysis with ALG3-specific antibodies

    • Glycoprotein analysis to confirm glycosylation patterns

    • Size exclusion chromatography to verify oligomeric state

  • Structural integrity assessment:

    • Limited proteolysis to assess proper folding

    • Circular dichroism spectroscopy for secondary structure analysis

How does strain background affect transcript stability and translation efficiency of recombinant ALG3 in K. lactis?

Strain background can significantly impact transcript stability and translation efficiency through multiple mechanisms. Research with other recombinant proteins in K. lactis has revealed complex relationships between strain genotype and expression outcomes.

Analysis of Northern blot data from different K. lactis strains expressing recombinant proteins shows that transcript levels do not always correlate with protein production. For instance, strain DR98 (derived from MW98-8C) demonstrated higher extracellular protein levels despite lower transcript abundance compared to other strains . This suggests that post-transcriptional and translational mechanisms significantly impact final protein yields.

For ALG3 expression, researchers should consider:

  • Codon optimization: Adapting the ALG3 gene to K. lactis codon preferences can enhance translation efficiency.

  • 5' and 3' UTR design: Untranslated regions influence mRNA stability and translation initiation.

  • Strain-specific factors: Different strains exhibit varying capacities for transcript processing, translation, and protein secretion.

  • RNA degradation pathways: Strain-specific differences in nonsense-mediated decay and other RNA surveillance mechanisms affect transcript stability.

Advanced researchers should perform time-course analyses of transcript levels (using qRT-PCR or Northern blotting) and protein production to identify strain-specific bottlenecks in the expression process.

What strategies can overcome bottlenecks in the secretory pathway when expressing recombinant ALG3 in K. lactis?

Expressing membrane-associated glycosylation enzymes like ALG3 presents unique challenges due to their natural localization in the endoplasmic reticulum (ER). Several strategies can address secretory pathway bottlenecks:

  • Co-expression of chaperones:

    • Overexpression of PDI (protein disulfide isomerase)

    • Co-expression of BiP/Kar2p to assist protein folding

    • Introduction of specialized chaperones for glycosyltransferases

  • Optimizing signal sequences:

    • Testing multiple ER targeting signals for optimal ALG3 localization

    • Engineering the native ALG3 transmembrane domains for proper insertion

  • Engineering strains with enhanced secretory capacity:

    • Using strains with modified unfolded protein response (UPR)

    • Testing strains with alterations in vesicular trafficking

  • Metabolic engineering approaches:

    • Adjusting expression of GTP/GDP-mannose pathway enzymes

    • Modifying dolichol-phosphate-mannose synthesis pathway

    • Engineering strains with altered glycosylation patterns

The specific K. lactis strain selected significantly impacts secretory pathway efficiency. Testing multiple strain backgrounds is essential for identifying optimal hosts for ALG3 expression. Strain MW98-8C and its derivatives have demonstrated superior performance for secreted proteins , suggesting they may possess favorable characteristics for managing ER protein load.

How can researchers assess the impact of recombinant ALG3 expression on native glycosylation pathways in K. lactis?

Expressing recombinant ALG3 mannosyltransferase may affect endogenous glycosylation pathways through substrate competition or altered pathway regulation. Advanced researchers should employ the following approaches to assess these effects:

  • Comprehensive glycomics analysis:

    • MALDI-TOF MS profiling of N-glycans before and after ALG3 expression

    • Lectin microarray analysis to detect subtle changes in glycan structures

    • Glycopeptide analysis using LC-MS/MS to identify site-specific alterations

  • Metabolic flux analysis:

    • Tracking dolichol-linked oligosaccharide intermediate pools

    • Measuring changes in nucleotide sugar donors (GDP-mannose)

    • Analyzing flux through the lipid-linked oligosaccharide synthesis pathway

  • Transcriptomics and proteomics:

    • RNA-Seq analysis to identify compensatory changes in expression of native glycosylation enzymes

    • Quantitative proteomics to measure changes in glycosylation machinery

    • Phosphoproteomics to detect altered signaling in response to ER stress

  • Functional implications assessment:

    • Protein secretion profiling to detect changes in glycoprotein processing

    • Cell wall composition analysis

    • Growth phenotype characterization under various stress conditions

What approaches can resolve low expression levels of recombinant ALG3 in K. lactis?

Low expression levels of recombinant ALG3 can result from multiple factors. The following systematic troubleshooting approach is recommended:

  • Strain selection optimization:

    • Test multiple K. lactis strains, focusing on MW98-8C and MW270-7B, which have demonstrated superior performance in recombinant protein expression

    • Consider integrative transformants, which generally show higher specific activity compared to replicative transformants

  • Expression construct optimization:

    • Verify codon optimization for K. lactis

    • Assess promoter strength and regulation (KlPDC1 promoter shows strong expression)

    • Optimize the Kozak sequence for efficient translation initiation

    • Ensure proper termination sequences (S. cerevisiae PHO5 terminator has proven effective)

  • Culture condition refinement:

    • Test both defined (SDA) and rich (YPD) media formulations

    • Optimize cultivation time (maximal expression typically occurs at 72-96 hours)

    • Adjust aeration and mixing parameters to enhance promoter activity

    • Monitor and control pH throughout the cultivation period

  • Molecular troubleshooting:

    • Verify mRNA levels through Northern blotting or qRT-PCR

    • Check for potential toxicity effects by monitoring growth curves

    • Assess protein stability and degradation

How can researchers distinguish between ALG3 enzyme activity and other mannosyltransferases in K. lactis?

Ensuring specificity when measuring ALG3 mannosyltransferase activity requires careful experimental design to differentiate it from other endogenous mannosyltransferases:

  • Substrate specificity approach:

    • Use purified Man₅GlcNAc₂-PP-Dol substrate, which is specific for ALG3

    • Compare activity with structural analogs that are not ALG3 substrates

    • Perform competitive inhibition studies with ALG3-specific inhibitors

  • Genetic approaches:

    • Generate ALG3 knockout strains as negative controls

    • Perform complementation studies in ALG3-deficient strains

    • Express epitope-tagged ALG3 for immunoprecipitation prior to activity assays

  • Biochemical distinguishing methods:

    • Determine precise kinetic parameters (Km, Vmax) for comparison with known values

    • Characterize pH optima and divalent cation requirements

    • Perform analysis with specific inhibitors of related mannosyltransferases

  • Advanced structural analysis:

    • Mass spectrometry analysis of reaction products

    • Structural identification of the specific α-1,3-mannose linkage

    • Nuclear magnetic resonance (NMR) spectroscopy to confirm linkage specificity

What strategies can address genetic instability in recombinant K. lactis strains expressing ALG3?

Genetic instability can compromise long-term expression of recombinant ALG3 in K. lactis. Based on experiences with other recombinant proteins, researchers should consider:

  • Integration strategy optimization:

    • Prefer integrative over replicative vectors for stable expression

    • Target integration to non-essential genomic regions

    • Verify integration by PCR and Southern blotting

    • Assess stability through multiple generations of non-selective growth

  • Selection pressure maintenance:

    • Develop dual selection systems

    • Consider antibiotic resistance markers for continuous selection

    • Implement auxotrophic complementation in defined media

  • Strain engineering approaches:

    • Select strain backgrounds with higher genetic stability

    • Engineer strains with reduced homologous recombination capacity

    • Consider diploid strains for increased genetic stability

  • Process development considerations:

    • Minimize generation numbers in production processes

    • Develop cell banking protocols with extensive testing

    • Implement regular monitoring of genetic stability

    • Establish quality control measures for expression level consistency

Research with other recombinant proteins in K. lactis has demonstrated that integrative transformants provide significantly better stability than replicative transformants, with 100% phenotype retention after multiple generations of non-selective growth .

How might CRISPR/Cas9 genome editing enhance recombinant ALG3 expression systems in K. lactis?

CRISPR/Cas9 technology offers transformative opportunities for optimizing ALG3 expression in K. lactis through precise genome editing:

  • Targeted integration optimization:

    • Precise integration of ALG3 expression cassettes at predetermined genomic loci

    • Multiplexed integration of multiple ALG3 copies

    • Simultaneous modification of multiple genomic targets to enhance expression

  • Host strain engineering:

    • Deletion of competing mannosyltransferases

    • Modification of secretory pathway components to reduce bottlenecks

    • Engineering of dolichol pathway enzymes to increase substrate availability

    • Disruption of proteases that might degrade recombinant proteins

  • Promoter and regulatory engineering:

    • Precise modification of native promoters for enhanced expression

    • Engineering of transcription factor binding sites

    • Creation of synthetic hybrid promoters optimized for ALG3 expression

  • Future research directions:

    • Development of K. lactis-optimized CRISPR systems with improved efficiency

    • Creation of genome-wide libraries for systematic optimization of ALG3 expression

    • Integration of CRISPR with high-throughput screening for rapid strain development

What emerging analytical techniques can provide deeper insights into recombinant ALG3 function and regulation?

Advanced analytical techniques are revolutionizing our understanding of glycosylation enzymes like ALG3. Researchers should consider these emerging approaches:

  • Single-cell omics technologies:

    • Single-cell transcriptomics to understand population heterogeneity in expression

    • Single-cell proteomics to identify cellular determinants of high expression

    • Spatial transcriptomics to visualize subcellular localization of mRNA

  • Advanced structural biology approaches:

    • Cryo-electron microscopy for membrane-associated ALG3 structural studies

    • Hydrogen-deuterium exchange mass spectrometry for dynamics analysis

    • AlphaFold2 and other AI-based structural prediction tools

  • Metabolic engineering analysis:

    • 13C metabolic flux analysis to understand precursor supply

    • Metabolomics focused on nucleotide sugar donors and dolichol intermediates

    • Real-time monitoring of glycosylation pathway metabolites

  • Systems biology approaches:

    • Multi-omics integration for comprehensive understanding of ALG3 expression

    • Mathematical modeling of glycosylation pathway dynamics

    • Genome-scale metabolic models incorporating glycosylation pathways

How might synthetic biology approaches revolutionize recombinant glycosylation enzyme production in K. lactis?

Synthetic biology offers transformative potential for optimizing recombinant ALG3 production in K. lactis:

  • Modular expression systems:

    • Standardized parts for K. lactis expression optimization

    • Promoter libraries with varying strengths and regulation patterns

    • Synthetic terminators optimized for mRNA stability

    • Standardized secretion tags and localization signals

  • Regulatory circuit engineering:

    • Feedback-regulated promoters responsive to product accumulation

    • Synthetic transcription factors for orthogonal control

    • RNA-based regulatory systems for post-transcriptional control

    • Design of genetic toggle switches for regulated expression

  • Pathway engineering:

    • Synthetic operons for coordinated expression of glycosylation pathway components

    • Compartmentalization strategies for improved pathway efficiency

    • Alternative glycosylation pathways with reduced complexity

    • Minimal synthetic glycosylation pathways

  • Genome minimization and chassis optimization:

    • Development of minimal K. lactis genomes optimized for heterologous expression

    • Elimination of competing pathways and unnecessary genes

    • Engineering of cellular resources allocation for maximal productivity

    • Integration of biosensors for real-time monitoring and control

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.