Recombinant Kluyveromyces lactis Formation of crista junctions protein 1 (FCJ1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
MIC60; KLLA0D02310g; MICOS complex subunit MIC60; Mitofilin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
13-535
Protein Length
Full Length of Mature Protein
Species
Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)
Target Names
MIC60
Target Protein Sequence
ASTNVPVKTARPFRNFLWKLGAATTVFYVGGVALSTYNYQFAELFTDNVPLAEELVQLVE SYNDGTLNAPQLSLDEIRKKFGSITRKVQSVPHLGSTSSTVTESQSIASGSGSTAAAATT GTDSNSVVLSSVPPVGSVLLRLPHLKLDDDSNSFNNKSFVESFNKQVDSLNEKEFILPEN AVESFLESYHGLSSQLNELNRDLADQLNSQLGQLSAELKQSVESDKVKEIESNKLQLMQQ FEKDLSNLKVEFEQKFDSQLQSSLKANEQAMLAKHKNELAMLSIKQVQEFNKIISNKIEN ERNGRLKNLDELNGSVKTVSDSLAALEETLLRSECVNQLTNLVSSIKFKLNLDNTPSLDI SKDLQKLTTLVNILPGKPNKCDAKEPQLIDVVVNELNSLTSAKENKQILSNEQLLNRWGL LQDKIREASLLPPNAGFLGHVSAKFFSLFLFNKSGISNENDIDSVISRVTENIKLNRLDK AVEDVVQLQGWSRLEADDWLQAARSKLELETLVDVVDHEIKTL
Uniprot No.

Target Background

Function

Recombinant Kluyveromyces lactis Formation of crista junctions protein 1 (FCJ1): A component of the Mitochondrial Contact Site and Cristae Organizing System (MICOS) complex. This large protein complex, located within the mitochondrial inner membrane, plays critical roles in maintaining crista junctions, preserving inner membrane architecture, and facilitating contact site formation with the outer membrane. FCJ1 contributes to the structural integrity of cristae membranes by connecting them to the inner boundary membrane and supports protein import through the mitochondrial intermembrane space assembly (MIA) pathway.

Database Links
Protein Families
MICOS complex subunit Mic60 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

How does FCJ1 affect mitochondrial morphology and function?

FCJ1 plays a crucial role in determining mitochondrial architecture. Studies using electron microscopy and tomography have demonstrated that:

  • Cells lacking FCJ1 (Δfcj1) completely lack crista junctions

  • Δfcj1 mitochondria exhibit concentric stacks of inner membrane in the mitochondrial matrix

  • Δfcj1 mitochondria show increased levels of F1FO-ATP synthase supercomplexes

Conversely, overexpression of FCJ1 leads to:

  • Increased crista junction formation (two- to threefold compared to control cells)

  • Branching of cristae

  • Enlargement of crista junction diameter

  • Reduced levels of F1FO supercomplexes

These findings indicate that FCJ1 is essential for normal mitochondrial cristae architecture and plays an antagonistic role to the F1FO-ATP synthase in determining membrane curvature .

What expression systems are optimal for producing recombinant K. lactis FCJ1?

Recombinant K. lactis FCJ1 can be successfully produced using E. coli expression systems. The typical approach includes:

  • Expressing the full-length mature protein (amino acids 13-535) fused to an N-terminal His-tag

  • Using Tris/PBS-based buffer with 6% trehalose at pH 8.0 as storage buffer

  • Providing the protein as either lyophilized powder or in liquid form

For optimal storage and stability:

  • Store at -20°C/-80°C upon receipt

  • Aliquot for multiple use to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

Reconstitution recommendations:

  • Centrifuge vial briefly before opening

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) for long-term storage

What are the challenges in expressing the functional domains of FCJ1 separately?

When expressing individual domains of FCJ1, researchers face several challenges that require specific methodological approaches:

  • Transmembrane domain expression:

    • Altering the transmembrane domain can affect protein functionality

    • Studies show that while the presence of a transmembrane segment is important, its specific amino acid sequence is not critical

    • Disrupting putative dimerization motifs (e.g., changing AXXXG to AXXXL) does not significantly affect function

  • C-terminal domain expression:

    • As the most conserved region, this domain requires careful handling

    • When expressing the C-terminal domain separately, it's essential to maintain proper folding

    • Complete deletion of this domain (as in Fcj1 1-472) results in loss of function

    • Expression of C-terminal domain mutants can exert dominant-negative effects

  • Domain-specific tagging:

    • His-tagging should be carefully positioned to avoid interfering with protein interactions

    • For investigating domain interactions, C-terminal tags may interfere with natural C-terminal interactions

How can researchers evaluate the impact of FCJ1 mutations on crista junction formation?

To assess the effects of FCJ1 mutations on crista junction formation, researchers can employ several methods:

  • Electron microscopy and tomography:

    • Chemical fixation of yeast cells followed by cryosectioning

    • Analysis of mitochondrial sections to quantify crista junctions

    • Measurement of the relative number of CJs per mitochondrial section

  • Quantitative analysis:
    Researchers can use control strains (e.g., Δfcj1/Fcj1 wt) as a reference (set to 100%) and compare mutants. Example data from published studies:

StrainRelative number of CJs per mitochondrial section (%)
Δfcj1/Fcj1 DLD1-TM68
Δfcj1/Fcj1 G52L124
Δfcj1/Fcj1 Cyt b246
Δfcj1/Fcj1 Δ166-342His4
Δfcj1/Fcj1 1-4729

What methods are used to study interactions between FCJ1 and other mitochondrial proteins?

Several approaches can be employed to investigate FCJ1 interactions:

  • Immunoprecipitation assays:

    • Using tagged versions of FCJ1 (e.g., His-tagged)

    • Pulling down protein complexes and analyzing by western blotting

    • Identifying interaction partners like TOB/SAM complex components

  • Immunogold electron microscopy:

    • Precise localization of FCJ1 at submitochondrial level

    • Establishing spatial relationships with other proteins

    • Studies show FCJ1 is most prominently clustered near crista junctions

  • Genetic interaction studies:

    • Creating double deletion mutants (e.g., Δfcj1/Δsu e)

    • Testing synthetic growth phenotypes

    • Analyzing epistatic relationships

  • Protein domain mapping:

    • Expressing truncated versions of FCJ1

    • Identifying which domains are required for specific interactions

    • The C-terminal domain of FCJ1 has been shown to interact with Tob55 of the TOB/SAM complex

How does the C-terminal domain of FCJ1 mediate its function in crista junction formation?

The C-terminal domain of FCJ1 is crucial for crista junction formation through several mechanisms:

  • Oligomer formation:

    • The C-terminal domain interacts with full-length FCJ1

    • This suggests a role in forming oligomeric structures necessary for crista junction stability

    • Deletion of this domain (Fcj1 1-472) severely impairs crista junction formation

  • Interactions with the TOB/SAM complex:

    • The C-terminal domain specifically interacts with Tob55 of the translocase of outer membrane β-barrel proteins (TOB/SAM) complex

    • This interaction helps stabilize crista junctions in close proximity to the outer membrane

    • The association of the TOB/SAM complex with contact sites depends on FCJ1 presence

  • Impact on mitochondrial architecture:

    • In the absence of the C-terminal domain, formation of crista junctions is strongly impaired

    • Irregular and stacked cristae are present

    • Only ~9% of normal crista junction numbers are observed

  • Genetic interactions:

    • The C-terminal domain is required for the genetic interaction of FCJ1 with subunit e of the F1FO ATP synthase

    • This suggests a role in modulating ATP synthase oligomerization

What is the relationship between FCJ1 and F1FO-ATP synthase in determining cristae morphology?

FCJ1 and F1FO-ATP synthase exhibit an antagonistic relationship that controls cristae architecture:

  • Opposing effects on membrane curvature:

    • FCJ1 promotes negative membrane curvature needed for crista junction formation

    • F1FO-ATP synthase (particularly subunits e and g) promotes positive membrane curvature at cristae tips

  • Regulation of F1FO oligomeric state:

    • FCJ1 overexpression reduces levels of F1FO supercomplexes

    • Deletion of FCJ1 increases levels of F1FO supercomplexes

    • In Δfcj1 mitochondria, F1FO particles are arranged in zipperlike patterns with regular spacing (14-16 nm)

  • Combined effects of mutations:

    • Deletion of both FCJ1 and F1FO subunit e/g disrupts the zipperlike arrangement of F1FO

    • This results in random distribution of F1FO particles with variable distances

    • Double mutants show intermediate cristae phenotypes

  • Model for cooperative function:

    • Local enrichment of FCJ1 at the base of crista junctions antagonizes F1FO oligomerization

    • This creates negative membrane curvature required for crista junction formation

    • Absence of FCJ1 at cristae tips allows F1FO oligomerization, creating positive membrane curvature

    • This spatial separation of opposing activities helps define cristae architecture

How can K. lactis expression systems be optimized for recombinant FCJ1 production?

While the search results primarily discuss E. coli-based expression of recombinant FCJ1, K. lactis itself can be used as an expression system with specific optimizations:

  • Vector design and integration:

    • Use of pKLAC1 vector system allows integration at the LAC4 locus

    • Creating linear expression cassettes by restriction digestion (e.g., BstXI)

    • Multi-copy integration can be achieved and verified by PCR with appropriate integration primers

  • Promoter selection:

    • The native LAC4 promoter can be used for efficient expression

    • Expression can be induced with lactose or galactose in the medium

  • Growth conditions:

    • Culture in YPGal medium (1% yeast extract, 2% bacto-peptone, and 2% lactose)

    • Shaking (~250 rpm) for 3 days at 30°C

    • Heat inactivation can be performed at 60°C for 2 hours if needed

  • Secretion strategies:

    • Use of synthetic secretion signals (e.g., K. lactis killer toxin pre-region)

    • Signal sequence processing is highly efficient (>95%)

    • Potential glycosylation sites should be considered, as they may affect protein activity

What are common challenges in working with recombinant FCJ1 and how can they be addressed?

Researchers working with recombinant FCJ1 often encounter several challenges:

  • Protein stability issues:

    • Problem: FCJ1 may degrade during storage or handling

    • Solution: Add 6% trehalose to storage buffer; maintain pH 8.0; store in aliquots to avoid repeated freeze-thaw cycles

  • Functional assessment:

    • Problem: Difficulty determining if recombinant protein maintains native function

    • Solution: Use complementation assays with Δfcj1 yeast strains; monitor restoration of normal mitochondrial morphology and crista junction formation

  • Solubility concerns:

    • Problem: Hydrophobic regions can cause aggregation

    • Solution: Use appropriate detergents; reconstitute in buffer containing glycerol (5-50% final concentration)

  • Expression yield optimization:

    • Problem: Low yield of full-length protein

    • Solution: Express as His-tagged fusion protein; optimize codon usage for expression host; consider domain-specific expression for structural studies

How do mutations in FCJ1 affect mitochondrial function beyond cristae morphology?

FCJ1 mutations impact mitochondrial function through several mechanisms beyond just altering cristae morphology:

  • Effects on respiratory chain function:

    • Altered cristae architecture can disrupt the organization of respiratory chain complexes

    • This may lead to reduced respiratory efficiency and ATP production

    • Particularly relevant in tissues with high energy demands

  • Impact on protein import:

    • FCJ1 interacts with the TOB/SAM complex involved in β-barrel protein import

    • While FCJ1 deletion doesn't significantly affect β-barrel protein biogenesis, it does alter the association of TOB/SAM with contact sites

    • This may indirectly affect protein import pathways

  • Influence on membrane potential:

    • Cristae architecture changes can affect the establishment and maintenance of membrane potential

    • This in turn may impact various mitochondrial functions including calcium handling and metabolite transport

  • Genetic interactions:

    • FCJ1 shows genetic interactions with F1FO-ATP synthase subunits e and g

    • These interactions suggest broader roles in coordinating mitochondrial inner membrane organization and function

What are emerging areas of research regarding FCJ1 and crista junction biology?

Several promising research directions are emerging in FCJ1 and crista junction biology:

  • Structural biology approaches:

    • High-resolution structures of FCJ1 domains, particularly the conserved C-terminal domain

    • Cryo-EM studies of FCJ1 in the context of the MICOS complex

    • Mechanistic understanding of how FCJ1 induces membrane curvature

  • Dynamic regulation of crista junctions:

    • Investigation of post-translational modifications of FCJ1

    • Temporal changes in crista junction formation during cellular stress

    • Regulation of FCJ1 expression and localization in response to metabolic cues

  • Therapeutic implications:

    • Understanding how crista junction disruption contributes to mitochondrial diseases

    • Development of approaches to modulate crista junction formation in disease states

    • Potential for targeting FCJ1 or related proteins in mitochondrial disorders

  • Evolutionary perspectives:

    • Comparative analysis of FCJ1 function across different species

    • Understanding how crista junction formation has evolved

    • Identification of organism-specific adaptations in crista junction biology

How might advanced imaging techniques enhance our understanding of FCJ1 function?

Advanced imaging approaches offer new possibilities for understanding FCJ1 function:

  • Super-resolution microscopy:

    • Techniques like STED, PALM, or STORM can resolve structures beyond the diffraction limit

    • This allows visualization of FCJ1 distribution and dynamics at nanoscale resolution

    • Potential to observe FCJ1 clusters and their relationship to crista junctions in living cells

  • Correlative light and electron microscopy (CLEM):

    • Combining fluorescence imaging of tagged FCJ1 with electron microscopy

    • Allows correlation of protein localization with ultrastructural features

    • Potential to track specific FCJ1 variants and their effects on crista morphology

  • Cryo-electron tomography:

    • Near-atomic resolution of mitochondrial membranes in their native state

    • Visualization of FCJ1 and associated complexes without fixation artifacts

    • Three-dimensional reconstruction of crista junction architecture

  • Live-cell imaging approaches:

    • Tracking FCJ1 dynamics using photoactivatable or photoconvertible fluorescent proteins

    • Monitoring crista junction remodeling in response to cellular signals

    • Studying the recruitment of FCJ1 during mitochondrial division or fusion events

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.