Recombinant Kluyveromyces lactis Golgi apparatus membrane protein TVP18 (TVP18)

What is Kluyveromyces lactis TVP18 and what is its biological significance?

Kluyveromyces lactis TVP18 (Uniprot: Q6CMQ1) is a Golgi apparatus membrane protein found in the yeast Kluyveromyces lactis. The protein consists of 171 amino acids with a full sequence: MVSVGFLKSMFNVSGMVADLKSSNFSIYGQWISYLNIIFCLAFGIANIFHFSAVIVFSII AIVQGLIILFIEVPFLLKICPLSDNFIGFVSKFDTNLRRALFYLVMCAIQWCSIIVQSTS LIVVAVGLSITATVYALGAAAGQEFKNSAILSDRGRVAASVTNEAVVRDmL . It plays a role in Golgi membrane organization and trafficking. As a model organism protein, TVP18 offers insights into eukaryotic secretory pathway mechanisms. Unlike Saccharomyces cerevisiae, K. lactis is predominantly respiratory rather than fermentative, making it valuable for comparative studies of cellular processes under different metabolic conditions .

How does K. lactis differ from S. cerevisiae as a model organism for studying membrane proteins?

K. lactis and S. cerevisiae represent complementary yeast models with significant differences relevant to membrane protein research. K. lactis demonstrates predominantly respiratory metabolism with higher glucose flow through the pentose phosphate pathway (PPP) than through glycolysis, leading to greater NADPH production in the cytosol . This contrasts with S. cerevisiae's fermentative nature. K. lactis lacks the whole genome duplication (WGD) event that occurred in S. cerevisiae's evolutionary history, resulting in fewer gene duplications and different regulatory patterns for membrane proteins .

Additionally, K. lactis exhibits distinct redox metabolism, with external alternative dehydrogenases (NDEs) using NADPH for reoxidation, which affects membrane protein expression under various oxygen conditions . These differences make K. lactis particularly valuable for studying membrane proteins like TVP18 in a respiratory eukaryotic context that may better approximate some aspects of higher eukaryotic cells.

What expression systems are recommended for recombinant production of K. lactis TVP18?

For recombinant production of K. lactis TVP18, researchers should employ modified K. lactis strains engineered for enhanced homologous recombination. Specifically, K. lactis ku80− strains have demonstrated superior efficiency for heterologous protein expression . These strains are defective in the non-homologous end-joining pathway (NHEJ), which typically mediates random integration of exogenous DNA into the genome .

The split-marker strategy has proven effective for constructing these mutant strains. Transformation with appropriate vectors (such as pKLAC1-based constructs) allows for efficient expression and potential secretion of the target protein . In comparative studies, ku80− mutants exhibited higher transformation efficiency than their respective parental strains (HP108 and JA6), with documented specific activity measurements for secreted recombinant proteins reaching 551.48 (±38.66) U/mg protein in HP108ku80−/cStpPlg1 cultures . This system leverages K. lactis's natural secretory capacity while minimizing random integration events that could disrupt optimal expression.

What are the optimal transformation protocols for introducing recombinant TVP18 constructs into K. lactis?

The optimal transformation protocol for K. lactis involves producing high yields of viable spheroplasts followed by introduction of the recombinant DNA construct. Key methodological considerations include:

• Spheroplast Preparation: Treat cells with a thiol-reducing agent (L-cysteine) and maintain them in high concentration osmotic stabilizer (1.5 M sorbitol) to achieve maximum spheroplast viability .

• Vector Selection: Utilize vectors containing K. lactis autonomous replication sequences (ARS) rather than S. cerevisiae ARS elements, as the latter fail to function effectively in K. lactis .

• Selection Strategy: Direct selection with G418 (geneticin) has proven effective when using the kanamycin resistance gene of Tn903 as a selection marker .

• Transformation Efficiency: ARS-containing plasmids selected in K. lactis can achieve transformation frequencies of 5-10 × 10² G418-resistant cells/μg of plasmid DNA .

• Stability Considerations: Plan for plasmid stability issues, as studies show that after 20 generations of growth under selection pressure, only 16-38% of cells maintain resistance, dropping to less than 5% without selection .

For TVP18 specifically, ku80− host strains are recommended as they demonstrate significantly higher transformation efficiency than wild-type strains .

How can researchers optimize K. lactis culture conditions for maximum TVP18 expression?

Optimizing K. lactis culture conditions for maximum TVP18 expression requires careful control of several parameters:

• Oxygen Regulation: K. lactis, unlike S. cerevisiae, requires at least minimal oxygen (>1% of fully aerobic levels) for growth, even during fermentation . Maintain precise oxygen levels using controlled bioreactors, as K. lactis cannot grow under strictly anoxic conditions .

• Redox Balance Management: Consider the higher glucose flow through the pentose phosphate pathway in K. lactis compared to glycolysis, which affects NADPH production and redox balance . This impacts protein expression and folding efficiency.

• Gene Regulation Approach: Unlike S. cerevisiae, K. lactis lacks duplicate genes with specialized aerobic/hypoxic transcription patterns. Instead, the single gene copies are regulated by oxygen availability . Design expression vectors that account for these regulatory differences.

• Selective Pressure Maintenance: Maintain appropriate selective pressure, as studies show significant decreases in plasmid retention (to below 5%) in the absence of selection pressure .

• Heme Availability: Monitor and potentially supplement heme, as the KlHEM1 gene in K. lactis is subject to double-feedback regulation by heme at both transcriptional and protein import levels, unlike the constitutive expression in S. cerevisiae .

When specifically expressing membrane proteins like TVP18, consider that the Golgi targeting and membrane integration may be affected by these conditions, requiring optimization based on experimental readouts.

What purification strategies yield the highest purity TVP18 preparations?

While the search results don't specifically address TVP18 purification, general membrane protein purification approaches can be adapted based on the provided information:

• Initial Extraction: Membrane proteins require detergent-based extraction from cellular membranes. For Golgi membrane proteins like TVP18, differential centrifugation techniques should first be employed to enrich for Golgi membrane fractions before detergent solubilization.

• Tag Selection: The provided product information indicates that "tag type will be determined during production process" , suggesting flexibility in tag selection. Consider affinity tags like His6, FLAG, or Strep-tag II depending on experimental requirements and downstream applications.

• Buffer Optimization: The commercial recombinant TVP18 is stored in "Tris-based buffer, 50% glycerol, optimized for this protein" . This suggests that Tris buffers with glycerol for stability are appropriate starting points for purification development.

• Storage Conditions: For maximum stability, store purified TVP18 at -20°C or -80°C for extended storage, while working aliquots can be maintained at 4°C for up to one week . Avoid repeated freeze-thaw cycles.

• Quality Control: Assess purity through SDS-PAGE, Western blotting (using anti-tag antibodies if applicable), and functional assays specific to membrane proteins, such as reconstitution studies or liposome incorporation tests.

How does oxygen availability affect TVP18 expression and function in K. lactis?

Oxygen availability significantly impacts TVP18 expression and function through multiple regulatory mechanisms in K. lactis. Unlike S. cerevisiae, K. lactis lacks duplicate genes with specialized aerobic/hypoxic transcription patterns, instead relying on oxygen-responsive regulation of single gene copies .

The regulatory factors controlling this response also differ between the species. In K. lactis, KlHAP1 does not function as a transcriptional activator of respiration or sterol biosynthesis genes as it does in S. cerevisiae but instead represses glucose transporter expression . Similarly, KlROX1 does not regulate the hypoxic response in K. lactis .

For membrane proteins like TVP18, these differences in oxygen-responsive regulation could significantly impact both expression levels and proper membrane integration, particularly for Golgi-targeted proteins within the secretory pathway.

What role does TVP18 play in the K. lactis secretory pathway compared to its homologs in other yeast species?

K. lactis diverged from S. cerevisiae prior to the whole genome duplication (WGD) event , suggesting that while S. cerevisiae might have duplicate genes for secretory pathway functions with specialized roles under different conditions, K. lactis likely maintains single copies with broader functions. This aligns with observations that K. lactis lacks the aerobic/hypoxic gene duplications seen in S. cerevisiae (like COX5a/COX5b, CYC1/CYC7, etc.) .

The amino acid sequence provided for TVP18 (MVSVGFLKSMFNVSGMVADLKSSNFSIYGQWISYLNIIFCLAFGIANIFHFSAVIVFSII AIVQGLIILFIEVPFLLKICPLSDNFIGFVSKFDTNLRRALFYLVMCAIQWCSIIVQSTS LIVVAVGLSITATVYALGAAAGQEFKNSAILSDRGRVAASVTNEAVVRDmL) suggests it contains multiple transmembrane domains characteristic of membrane trafficking proteins.

Research examining functional complementation between K. lactis TVP18 and homologs from other species would be valuable, similar to studies done with other genes where cross-complementation confirmed functional equivalence between K. lactis and S. cerevisiae homologs .

How do redox conditions affect TVP18 stability and functionality in experimental systems?

The impact of redox conditions on TVP18 stability and functionality can be inferred based on the distinct redox metabolism of K. lactis compared to other yeast models. K. lactis exhibits a higher glucose flow through the pentose phosphate pathway than through glycolysis, resulting in increased NADPH production in the cytosol . This fundamental metabolic difference likely influences membrane protein folding, stability, and function.

K. lactis relies significantly on mitochondrial external alternative dehydrogenases (NDEs) for NADPH reoxidation , creating a distinct redox environment compared to S. cerevisiae. This could impact disulfide bond formation and protein folding in the secretory pathway, potentially affecting TVP18's structure and function.

The oxidative stress response in K. lactis also differs from S. cerevisiae, with unique transcriptional regulation patterns for antioxidant enzymes . For example, while S. cerevisiae increases glutathione reductase (GLR) expression under oxidative stress through Yap1-mediated mechanisms, this effect is absent in K. lactis .

These differences suggest that experimental design for TVP18 studies should account for K. lactis-specific redox conditions, particularly when investigating protein stability, folding, and functionality. Standard redox protocols developed for S. cerevisiae may require significant modification for optimal results with K. lactis membrane proteins.

How conserved is TVP18 across different yeast species, and what does this reveal about its function?

Quantitative analyses of homology between verified or putative orthologous genes of K. lactis and S. cerevisiae have been performed for various proteins . Similar analyses for TVP18 would likely reveal important insights about functional conservation. Given that K. lactis diverged from S. cerevisiae before the whole genome duplication (WGD) event , TVP18 likely represents an ancestral form that might have duplicated and specialized in post-WGD yeasts.

Functional studies examining whether TVP18 from K. lactis can complement mutations in homologous genes from other yeasts would be particularly valuable. Such cross-complementation studies have been performed for other genes in K. lactis, such as components of the heme biosynthetic pathway (KlHEM1, KlHEM12, and KlHEM13) .

The amino acid sequence of TVP18 (as provided in result ) could be used for phylogenetic analyses to trace its evolutionary history across the yeast phylogeny and identify conserved domains that likely correspond to essential functional regions of the protein.

What genetic modifications of K. lactis strains optimize TVP18 expression and functional studies?

Several genetic modifications have proven effective for optimizing heterologous protein expression in K. lactis and would likely benefit TVP18 studies:

• KU80 Gene Disruption: Construction of ku80− strains defective in the non-homologous end-joining pathway (NHEJ) significantly increases homologous recombination efficiency . These strains show higher transformation efficiency than wild-type strains (HP108 and JA6) and improved production of recombinant proteins .

• Split-Marker Strategy: This approach has proven effective for introducing precise genetic modifications in K. lactis, particularly when creating knockout strains .

• Vector Selection: pKLAC1-based vectors have demonstrated success for heterologous gene expression in K. lactis . For TVP18 studies, these vectors could be modified to include appropriate regulatory elements.

• Secretion Signal Optimization: While TVP18 is a membrane protein, fusion constructs with appropriate secretion signals have shown high specific activity measurements (up to 551.48 ±38.66 U/mg protein) in K. lactis culture supernatants .

• ARS Selection: K. lactis-specific autonomous replication sequences (ARS) must be used, as S. cerevisiae ARS elements (including ARS1 and 2μ replicon) fail to function in K. lactis . Similarly, S. cerevisiae centromere sequences do not increase plasmid stability in K. lactis .

These genetic modifications create a robust platform for TVP18 expression and functional characterization in a system that maintains proper redox balance and membrane protein processing.

How does the absence of whole genome duplication in K. lactis affect TVP18 regulation compared to potential homologs in S. cerevisiae?

The absence of whole genome duplication (WGD) in K. lactis creates significant differences in gene regulation compared to S. cerevisiae, with important implications for TVP18 regulation:

• Single Copy Genes vs. Duplicates: While S. cerevisiae often has duplicate genes (like COX5a/COX5b, CYC1/CYC7, HYP2/ANB1, AAC1/AAC2/AAC3) that are differentially expressed under aerobic and hypoxic conditions, K. lactis typically has single gene copies regulated by oxygen availability . This suggests TVP18 in K. lactis likely handles multiple functions that might be divided among specialized duplicates in S. cerevisiae.

• Transcriptional Regulation Differences: The transcriptional machinery regulating gene expression differs substantially between the species. For instance, KlHAP1 does not function as a transcriptional activator of respiration or sterol biosynthesis genes as its S. cerevisiae counterpart does . Similarly, KlROX1 does not regulate the hypoxic response in K. lactis as ROX1 does in S. cerevisiae .

• Evolutionary Implications: These regulatory differences likely reflect adaptations to different ecological niches, with K. lactis maintaining predominantly respiratory metabolism while S. cerevisiae favors fermentation even in aerobic conditions (Crabtree effect) .

• Functional Conservation Despite Regulatory Divergence: For many genes, functional equivalence between K. lactis and S. cerevisiae homologs has been confirmed experimentally by cross-complementation , suggesting that despite regulatory differences, core protein functions may be conserved.

This pattern of single-copy genes with potentially broader functions in K. lactis could make TVP18 particularly valuable for understanding the ancestral functions of Golgi membrane proteins before subfunctionalization occurred in post-WGD yeasts.

What are common challenges in working with recombinant K. lactis TVP18 and how can they be addressed?

While the search results don't specifically address challenges with TVP18, several common issues when working with K. lactis recombinant proteins can be anticipated and addressed:

• Plasmid Stability Issues: Studies show that even under selection pressure, only 16-38% of cells maintain plasmids after 20 generations, dropping to less than 5% without selection . Solution: Maintain constant selection pressure and consider refreshing cultures frequently from verified stocks.

• Inefficient Transformation: Traditional transformation methods yield low efficiency. Solution: Use the optimized spheroplast preparation method with thiol-reducing agent (L-cysteine) and high concentration osmotic stabilizer (1.5 M sorbitol) , and consider ku80− strains which show improved transformation efficiency .

• Heterologous Promoter Function: Some S. cerevisiae promoters function poorly in K. lactis. Solution: Use native K. lactis promoters or validated heterologous promoters known to function in K. lactis.

• Membrane Protein Folding Challenges: As a Golgi membrane protein, TVP18 requires proper folding and trafficking. Solution: Consider lower expression temperatures, test different induction strategies, and evaluate fusion constructs that may improve folding.

• Species-Specific Regulatory Factors: K. lactis transcription factors respond differently to environmental cues compared to S. cerevisiae . Solution: Optimize culture conditions specifically for K. lactis rather than applying S. cerevisiae protocols directly.

For membrane proteins specifically, detergent screening during extraction and purification will likely be a critical optimization step to maintain protein structure and function.

How can researchers assess and verify the proper folding and localization of recombinant TVP18?

Assessing proper folding and localization of recombinant TVP18 requires multiple complementary approaches:

• Subcellular Fractionation: Perform differential centrifugation to isolate Golgi membrane fractions, followed by Western blotting to detect TVP18 specifically in Golgi-enriched fractions.

• Fluorescent Protein Fusions: Create C-terminal or N-terminal GFP (or other fluorescent protein) fusions with TVP18, ensuring the tag doesn't disrupt targeting signals, and visualize localization using fluorescence microscopy co-stained with known Golgi markers.

• Epitope Tagging and Immunolocalization: Incorporate small epitope tags (HA, FLAG, etc.) and use immunofluorescence with co-staining of established Golgi markers to verify proper localization.

• Protease Protection Assays: Determine the topology of TVP18 within membranes by treating isolated membrane fractions with proteases in the presence or absence of detergents to assess which protein regions are protected.

• Glycosylation Status Analysis: Examine N-linked glycosylation patterns as markers of proper progression through the secretory pathway, using endoglycosidase treatments and mobility shift assays.

• Functional Complementation: Test whether the recombinant TVP18 can rescue phenotypes in yeast strains with mutations in the endogenous gene or potential homologs, providing functional verification of proper folding.

These approaches collectively provide strong evidence for proper expression, folding, and localization of this Golgi membrane protein.

What are the key differences in oxidative stress responses between K. lactis and S. cerevisiae that might affect TVP18 studies?

Several critical differences in oxidative stress responses between K. lactis and S. cerevisiae could significantly impact TVP18 studies:

These differences necessitate K. lactis-specific approaches when studying membrane proteins like TVP18 under various oxidative conditions.