Recombinant Kluyveromyces lactis Golgi apparatus membrane protein TVP38 (TVP38)

Shipped with Ice Packs
In Stock

Description

Domain Architecture

  • Transmembrane Topology: TVP38 contains five predicted transmembrane helices, consistent with its classification in the DedA protein family .

  • Conserved Motifs:

    • GxxxM/VxxxxF/Y: A glycine-rich motif implicated in membrane interaction.

    • F/YxxxR/K: A polar motif potentially involved in protein folding or oligomerization .

  • LeuT-Fold Homology: Structural modeling suggests a LeuT-like fold, common in transport proteins, indicating possible roles in substrate binding or ion coupling .

Biological Roles

  • Vesicle Trafficking: TVP38 co-localizes with Golgi-associated SNARE proteins (e.g., Tlg2) in yeast, suggesting involvement in cargo selection or vesicle budding .

  • Membrane Integrity: Homologs in cyanobacteria (Synechocystis sp. PCC 6803) and chloroplasts are linked to thylakoid membrane biogenesis, hinting at conserved roles in stabilizing internal membrane systems .

Evolutionary Conservation

TVP38 homologs are widespread:

  • Eukaryotes: Humans, Saccharomyces cerevisiae, and plants (e.g., Arabidopsis thaliana chloroplast protein At1g22850) .

  • Prokaryotes: Bacterial DedA proteins (e.g., Synechocystis Slr0232, Slr0305) .

  • Notable Exception: Absent in Gloeobacter violaceus, a cyanobacterium lacking thylakoid membranes, supporting its association with internal membrane systems .

Research Applications

  • Membrane Protein Studies: Used to investigate vesicle-mediated transport mechanisms in fungal models .

  • Biotechnological Engineering: K. lactis is a GRAS (Generally Recognized As Safe) organism, making recombinant TVP38 suitable for industrial enzyme production systems .

Unresolved Questions

  • Mechanistic Role: Direct evidence for TVP38’s cargo selection or membrane fusion activity remains elusive .

  • Redundancy in Cyanobacteria: Functional overlap among multiple DedA homologs (e.g., Slr0232 vs. Slr0305) requires further exploration .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is finalized during production. If you require a specific tag, please specify it in advance, and we will prioritize its incorporation.
Synonyms
TVP38; KLLA0A07667g; Golgi apparatus membrane protein TVP38
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-305
Protein Length
full length protein
Species
Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)
Target Names
TVP38
Target Protein Sequence
MADLYEARVSSGGLSRPSDTDFLDSNDNFDDLDDDFLDIYNLSWRQRIVQHGKRHLRNGK DKFNALSRRKKALVVFLGVLEIILIFITVVKREAIMKGLVDASNDLRQKWYTPLVLMLLI LAVSFPPLIGYSFLSLSTGLIYGLSFKGWFILAMSTVIGSVLSFTVFQRLLHSHAERLIR MNPKLEAVSSVLQGNDSYWMIALIRLCPFPYSFINGAIAGIYGISIKNFAIANIITTPKA VIYLFVGERLKNMGETDSGSTRLINFISILLANGFLILTTWFLYYRFKKRYLELQSEQQN SFDIF
Uniprot No.

Target Background

Function

Golgi membrane protein involved in vesicular trafficking and spindle migration.

Database Links
Protein Families
TVP38/TMEM64 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What expression vectors are most suitable for producing recombinant TVP38 in K. lactis?

The pKLAC1 vector system is highly recommended for expressing TVP38 in K. lactis. This vector contains the LAC4 promoter, which can be integrated into the K. lactis genome at the LAC4 locus through homologous recombination . The expression cassette can be prepared by digesting the constructed plasmid (e.g., pKLAC1-TVP38) with BstXI to create a linear expression cassette before transformation into competent K. lactis GG799 cells by electroporation . Successful transformants can be selected using YCB medium containing 5 mM acetamide and confirmed through PCR screening using Integration Primers (P1, P2, and P3) .

How can I verify successful integration and expression of TVP38 in K. lactis?

Verification of successful integration can be performed using whole-cell PCR with specific integration primers. Single-copy or tandem-vector integration at the LAC4 locus can be detected by PCR using primers P1 and P2 to amplify a 1.9 kb fragment, while multi-copy integration can be detected using P2 and P3 to amplify a 2.3 kb fragment . Expression of TVP38 can be confirmed through Western blot analysis after growing the recombinant K. lactis in YPGal medium (1% yeast extract, 2% bacto-peptone, and 2% lactose) with shaking at ~250 rpm for 3 days at 30°C .

What are the optimal growth conditions for K. lactis strains expressing recombinant proteins?

For optimal growth and protein expression, K. lactis strains should be cultured in YPGal medium at 30°C with shaking at approximately 250 rpm . The growth rate can vary among different K. lactis strains, with some newly isolated strains demonstrating up to 25% shorter duplication times compared to standard strains like K. lactis ATCC8585 . Monitoring growth parameters is essential as some strains may demonstrate faster growth rates, potentially improving recombinant protein yield within shorter timeframes.

How can I identify and confirm the species identity of my K. lactis strain?

K. lactis strain identification can be performed using both biochemical and molecular methods:

  • Biochemical identification: API32C kit (Biomerieux) can be used for preliminary species identification .

  • Molecular identification: PCR-RFLP analysis of the ITS1-5.8S rDNA-ITS2 region using ITS1 (5′-TCCGTAGGTGAACCTGCGG-3′) and ITS4 (5′-TCCTCCGCTTATTGATATGC-3′) primers, followed by HinfI digestion . K. lactis strains typically show a distinctive pattern of four DNA fragments of approximately 297±4 bp, 195±5 bp, 128±3 bp, and 91±1 bp .

  • Sequence confirmation: Direct sequencing of the PCR-amplified ITS1-5.8S rDNA-ITS2 region can provide definitive species identification .

What experimental design approaches are most effective for studying TVP38 function in K. lactis?

A true experimental design approach is recommended for studying TVP38 function, which should include:

  • Random assignment of samples to control and experimental groups

  • Controlled manipulation of independent variables

  • Precise measurement of dependent variables

  • Rigorous statistical analysis of results

For TVP38 functional studies, a factorial pretest-posttest control group design is particularly valuable, as it allows for the assessment of multiple factors simultaneously while controlling for potential confounding variables . This approach would involve:

  • Division of samples into multiple groups based on different experimental conditions

  • Collection of baseline data before experimental manipulation

  • Implementation of controlled experimental treatments

  • Post-treatment data collection and comparative analysis against baseline measurements and control groups

This experimental design provides robust data on TVP38 function while minimizing bias and enhancing the reliability of results.

How can I optimize the expression of TVP38 in K. lactis under various growth conditions?

Optimization of TVP38 expression in K. lactis requires systematic analysis of multiple factors affecting protein production. Based on studies with other recombinant proteins in K. lactis, expression can be significantly affected by carbon source regulation . A methodological approach includes:

  • Testing different carbon sources: Compare growth and expression in media containing glucose (repressing) versus lactose or galactose (inducing).

  • Evaluate copy number effects: Multi-copy integrants often show higher expression levels than single-copy integrants.

  • Temperature optimization: Test expression at different temperatures (25°C, 30°C, and 37°C).

  • Induction timing: Determine optimal cell density for induction.

Carbon SourceCopy NumberTemperature (°C)Relative TVP38 Expression
GlucoseSingle30+
GlucoseMulti30++
LactoseSingle30+++
LactoseMulti30++++
GalactoseSingle30+++
GalactoseMulti30++++
LactoseMulti25+++
LactoseMulti37++

Note: This table represents expected relative expression levels based on known patterns for recombinant protein expression in K. lactis.

What immune responses are triggered by recombinant TVP38 expressed in K. lactis, and how can they be accurately measured?

When using K. lactis for producing TVP38 as a potential immunogen, several immune responses can be evaluated:

  • Humoral immunity assessment:

    • PRRSV-specific sIgA antibody production in intestinal mucosa (for oral administration)

    • Measurement of serum antibody titers (for subcutaneous administration)

  • Cell-mediated immunity evaluation:

    • Lymphocyte proliferation assay to assess T-cell responses

    • Flow cytometry analysis of IFN-γ production in CD4+ and CD8+ T cells

    • Measurement of cytokine profiles (e.g., IL-4, IFN-γ) in stimulated splenocytes

The methodology for measuring these responses involves:

  • Isolation of splenocytes from immunized animals

  • In vitro restimulation with purified TVP38

  • Quantification of proliferation using methods such as [3H]-thymidine incorporation or MTT assay

  • Flow cytometric analysis of intracellular cytokine production in T cell subsets

How do post-translational modifications of TVP38 in K. lactis differ from those in other expression systems?

As a eukaryotic expression system, K. lactis offers advantages for the expression of proteins requiring post-translational modifications. Analysis of TVP38 post-translational modifications should include:

  • Glycosylation pattern analysis:

    • K. lactis typically produces less hyperglycosylated proteins compared to S. cerevisiae

    • N-linked glycosylation sites can be analyzed by PNGase F digestion followed by SDS-PAGE and Western blotting

    • Detailed glycan structure can be determined by mass spectrometry

  • Protein folding and disulfide bond formation:

    • K. lactis provides the oxidizing environment necessary for proper disulfide bond formation

    • Correct folding can be assessed through functional assays and circular dichroism spectroscopy

  • Comparative analysis with other expression systems:

    • Side-by-side comparison with TVP38 expressed in bacterial systems (E. coli), other yeasts (S. cerevisiae), and mammalian cells (CHO cells)

    • Evaluation of biological activity, stability, and immunogenicity of differentially expressed TVP38

What are the molecular mechanisms regulating TVP38 trafficking to the Golgi apparatus in K. lactis?

Understanding TVP38 trafficking to the Golgi apparatus requires sophisticated experimental approaches:

  • Fluorescent protein tagging:

    • C- or N-terminal fusion of TVP38 with GFP or mCherry

    • Live-cell imaging to track protein movement through secretory pathway

    • Co-localization studies with known Golgi markers

  • Mutational analysis:

    • Systematic mutation of putative targeting signals in TVP38

    • Creation of chimeric proteins to identify trafficking determinants

    • Assessment of localization changes through microscopy and subcellular fractionation

  • Interactome analysis:

    • Immunoprecipitation coupled with mass spectrometry to identify TVP38 binding partners

    • Yeast two-hybrid screening to detect protein-protein interactions

    • Validation of key interactions through co-immunoprecipitation and FRET analysis

What purification strategies are most effective for isolating recombinant TVP38 from K. lactis?

For efficient purification of recombinant TVP38 from K. lactis, a multi-step purification strategy is recommended:

  • Expression with affinity tags:

    • Construct TVP38 with a C-terminal His-tag (TVP38-His) using appropriate vectors like pKLAC1

    • Express in K. lactis using optimized conditions as described previously

  • Cell lysis and membrane protein extraction:

    • Harvest cells and wash with PBS

    • Lyse cells using mechanical disruption (glass beads or French press)

    • Extract membrane proteins using detergents like n-dodecyl-β-D-maltoside (DDM) or Triton X-100

  • Affinity chromatography:

    • Apply solubilized proteins to Ni-NTA or TALON resin

    • Wash extensively to remove non-specifically bound proteins

    • Elute TVP38-His with imidazole gradient

  • Additional purification steps:

    • Size-exclusion chromatography to separate monomeric from aggregated protein

    • Ion-exchange chromatography for further purification

    • Analyze purity by SDS-PAGE and Western blotting

How can I design a rigorous experiment to assess the impact of TVP38 knockout/overexpression on K. lactis cellular function?

A comprehensive approach to studying TVP38 function through knockout/overexpression includes:

  • Generation of TVP38 knockout strain:

    • CRISPR-Cas9 mediated gene deletion

    • Confirmation of knockout through PCR and sequencing

    • Phenotypic characterization including growth rate, morphology, and stress tolerance

  • Construction of TVP38 overexpression strain:

    • Integration of additional TVP38 copies under strong constitutive or inducible promoters

    • Verification of overexpression by qRT-PCR and Western blotting

    • Phenotypic characterization as with knockout strains

  • Experimental design for functional assessment:

    • True experimental design with appropriate controls (wild-type and empty vector strains)

    • Multiple biological and technical replicates to ensure statistical validity

    • Factorial design to test multiple conditions simultaneously

  • Comprehensive phenotypic analysis:

    • Growth curves under various conditions (different carbon sources, temperatures, pH)

    • Microscopic analysis of Golgi structure and function

    • Proteomics and transcriptomics to identify global changes

  • Statistical analysis:

    • ANOVA for multi-factorial experiments

    • Post-hoc tests to identify specific differences between conditions

    • Multiple testing correction to control false discovery rate

What advanced imaging techniques are most suitable for studying TVP38 localization and dynamics in K. lactis?

Advanced imaging approaches for TVP38 localization and dynamics include:

  • Confocal microscopy:

    • Live-cell imaging of fluorescently tagged TVP38

    • Co-localization with organelle markers (e.g., Golgi, ER)

    • Time-lapse imaging to track dynamic changes

  • Super-resolution microscopy:

    • STED (Stimulated Emission Depletion) microscopy for nanoscale resolution

    • Single-molecule localization microscopy (PALM/STORM) for precise protein positioning

    • SIM (Structured Illumination Microscopy) for improved resolution of Golgi structures

  • Correlative Light and Electron Microscopy (CLEM):

    • Combination of fluorescence microscopy with electron microscopy

    • Precise localization of TVP38 within ultrastructural context

    • Immunogold labeling for EM visualization

  • Fluorescence Recovery After Photobleaching (FRAP):

    • Assessment of TVP38 mobility within membranes

    • Calculation of diffusion coefficients and mobile fractions

    • Comparison between wild-type and mutant TVP38 variants

  • Förster Resonance Energy Transfer (FRET):

    • Investigation of protein-protein interactions in living cells

    • Analysis of conformational changes in TVP38

    • Measurement of molecular proximity with potential binding partners

How can I address poor expression levels of recombinant TVP38 in K. lactis?

Poor expression of TVP38 may result from various factors. A systematic troubleshooting approach includes:

  • Codon optimization:

    • Analyze the TVP38 coding sequence for rare codons in K. lactis

    • Optimize the sequence for improved translation efficiency

    • Synthesize the codon-optimized gene and reclone into the expression vector

  • Vector and promoter selection:

    • Test alternative promoters beyond LAC4, such as PGK1 or ADH1

    • Compare expression levels between integrative and episomal vectors

    • Evaluate the impact of different signal sequences on expression

  • Growth and induction conditions:

    • Optimize temperature, pH, and media composition

    • Test different induction strategies (timing, inducer concentration)

    • Evaluate the effect of cell density at induction

  • Clone stability assessment:

    • Verify maintenance of the expression cassette over multiple generations

    • Check for potential toxicity of TVP38 expression

    • Implement selection pressure throughout the cultivation process

What strategies can help resolve inconsistent experimental results when studying TVP38 function?

Inconsistent results in TVP38 functional studies may be addressed through:

  • Experimental design improvements:

    • Implement true experimental designs with appropriate controls

    • Increase sample sizes to improve statistical power

    • Use factorial designs to understand interaction effects

  • Standardization of procedures:

    • Develop detailed SOPs for all experimental protocols

    • Use consistent cultivation conditions and media preparations

    • Standardize analytical methods and data collection

  • Control for biological variation:

    • Use clonal populations rather than mixed cultures

    • Account for growth phase effects by synchronizing cultures

    • Control environmental variables rigorously

  • Statistical approach:

    • Apply appropriate statistical tests based on experimental design

    • Implement multifactorial analysis when appropriate

    • Use power analysis to determine adequate sample sizes

How can I distinguish between endogenous and recombinant TVP38 protein in my experimental system?

Distinguishing between endogenous and recombinant TVP38 requires specific strategies:

  • Epitope tagging:

    • Add unique epitope tags (His, FLAG, HA) to recombinant TVP38

    • Use tag-specific antibodies for selective detection

    • Verify that tags do not interfere with protein function or localization

  • Species-specific sequence differences:

    • If expressing TVP38 from another species, use species-specific antibodies

    • Design primers that selectively amplify either endogenous or recombinant gene

    • Use mass spectrometry to identify species-specific peptides

  • Quantitative approaches:

    • Perform quantitative Western blotting to measure total TVP38 levels

    • Compare expression levels between transformed and untransformed controls

    • Use qRT-PCR to measure transcript levels from endogenous and recombinant genes

  • Genetic approaches:

    • Generate a background strain with the endogenous TVP38 gene deleted

    • Express recombinant TVP38 in this background to eliminate endogenous protein

    • Use inducible promoters to control recombinant expression and compare to baseline

What statistical approaches are most appropriate for analyzing TVP38 functional data?

Selection of statistical methods depends on experimental design and data characteristics:

  • For comparing expression levels between different strains or conditions:

    • One-way or multifactorial ANOVA for comparing multiple groups

    • Post-hoc tests (Tukey's HSD, Bonferroni) for pairwise comparisons

    • Non-parametric alternatives (Kruskal-Wallis, Mann-Whitney) if normality assumptions are violated

  • For dose-response relationships:

    • Regression analysis to model relationships between variables

    • Determination of EC50 or IC50 values for functional assays

    • Curve fitting to appropriate mathematical models

  • For time-course experiments:

    • Repeated measures ANOVA or mixed-effects models

    • Growth curve fitting and parameter extraction

    • Time series analysis for complex temporal patterns

  • For high-throughput data (proteomics, transcriptomics):

    • Multiple testing correction (FDR, Bonferroni)

    • Dimension reduction techniques (PCA, t-SNE)

    • Pathway and network analysis to contextualize results

How can I integrate multiple data types to develop a comprehensive model of TVP38 function in K. lactis?

Integration of diverse data types requires sophisticated computational approaches:

  • Data integration framework:

    • Develop a systematic approach to combining disparate data types

    • Normalize data appropriately to enable cross-platform comparisons

    • Use both data-driven and knowledge-based integration methods

  • Multi-omics analysis:

    • Correlate transcriptomic, proteomic, and metabolomic changes

    • Identify key nodes in biological networks affected by TVP38

    • Apply pathway enrichment analysis across multiple data types

  • Mathematical modeling:

    • Develop kinetic models of TVP38-mediated processes

    • Use network models to predict system-wide effects

    • Apply machine learning for pattern recognition across datasets

  • Validation strategies:

    • Design targeted experiments to test model predictions

    • Iteratively refine models based on new experimental data

    • Assess model robustness through sensitivity analysis

What are the most promising future research directions for understanding TVP38 function in K. lactis?

Several directions show particular promise for advancing TVP38 research:

  • Structural biology approaches:

    • Cryo-EM structure determination of TVP38 in native membrane environment

    • X-ray crystallography of purified TVP38

    • Molecular dynamics simulations to understand conformational changes

  • Systems biology integration:

    • Multi-omics profiling of TVP38 mutants across various conditions

    • Network analysis to position TVP38 within cellular pathways

    • Comparative genomics across yeast species to identify conserved functions

  • Applied biotechnology developments:

    • Engineering TVP38 for enhanced recombinant protein production

    • Developing TVP38-based systems for membrane protein expression

    • Creating biosensors based on TVP38 function

  • Advanced genetic approaches:

    • CRISPR interference for tunable repression of TVP38

    • Synthetic genetic array analysis to identify genetic interactions

    • Conditional degron systems for temporal control of TVP38 function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.