Recombinant Kluyveromyces lactis High osmolarity signaling protein SHO1 (SHO1)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Kluyveromyces lactis High Osmolarity Signaling Protein SHO1 (SHO1) is a transmembrane protein critical for mediating cellular responses to hyperosmotic stress through the High Osmolarity Glycerol (HOG) pathway. This pathway enables yeast cells to adapt to osmotic imbalances by regulating glycerol synthesis and transport. SHO1 acts as a scaffold protein, integrating signals from membrane sensors to downstream kinases, including Ste11 and Pbs2, which activate the MAP kinase Hog1 .

Functional Role in the HOG Pathway

SHO1 operates within the SHO1 branch of the HOG pathway, which works redundantly with the SLN1 branch to ensure robust stress adaptation . Key interactions include:

  • Scaffold Activity: Recruits Ste11 and Pbs2 to form a signaling complex at the plasma membrane .

  • Cross-Branch Redundancy: Inactivation of both SHO1 and SLN1 branches (e.g., ΔKlsho1ΔKlssk2 mutants) renders cells osmosensitive, while single deletions (ΔKlsho1 or ΔKlssk2) remain viable due to branch redundancy .

  • Phosphorylation Dynamics: KlHog1 phosphorylation requires SHO1-dependent activation of Pbs2, even in mutants lacking canonical inputs .

Recombinant Studies and Engineering

Recombinant approaches have elucidated SHO1’s functional plasticity:

Table 1: Key Recombinant Constructs and Phenotypes

ConstructFunctionality in ΔKlsho1ΔKlssk2 MutantsOsmoprotectionMating CompetenceSource
Wild-type KlSho1Partial restorationYesN/A
KlSho1 transmembrane segmentsNoNoN/A
KlSho1/Ste11 chimeric proteinFull restorationYesNo
  • Chimeric Protein Engineering: Fusion of KlSho1’s transmembrane domains to Ste11 rescued osmotolerance in ΔKlsho1ΔKlssk2 mutants, demonstrating that membrane anchoring bypasses canonical scaffolding .

  • Functional Limitations: The chimeric protein failed to restore mating, indicating pathway-specific recruitment requirements .

Table 2: Phenotypic Consequences of SHO1 Inactivation

MutantHog1 PhosphorylationKlSTL1 ExpressionOsmoresistanceSource
ΔKlsho1YesYesYes
ΔKlste11Yes (ineffective)NoNo
ΔKlsho1ΔKlssk2Yes (ineffective)NoNo
  • Ineffective Phosphorylation: In ΔKlste11 and ΔKlsho1ΔKlssk2 mutants, Hog1 phosphorylation occurs but fails to activate osmoprotective genes like KlSTL1, highlighting SHO1’s role in signaling fidelity .

  • Kinase Dependency: KlPbs2’s kinase activity is essential for Hog1 phosphorylation, even in non-canonical activation scenarios .

Applications and Industrial Relevance

Recombinant SHO1 studies inform biotechnological applications:

  • Stress-Tolerant Strains: Engineering membrane-anchored Ste11 variants could enhance osmotolerance in industrial yeast strains .

  • Secretory Pathway Optimization: Overexpression of secretory genes (e.g., SSO1, SEB1) in K. lactis improves protein yields, a strategy applicable to SHO1-related pathway engineering .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein with deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of our proteins is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please inform us, and we will prioritize the development of your specified tag.
Synonyms
SHO1; KLLA0E06953g; High osmolarity signaling protein SHO1; Osmosensor SHO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-357
Protein Length
full length protein
Species
Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)
Target Names
SHO1
Target Protein Sequence
MALIKASQARAVRENPHVSHQFNISSFLGDPFAIGTLSIALISWIIALAGSIAVAASTSP FPRFSWWTIVYEILLMITLFIVYCLDLVDYYRMFITCAVGIAFVYTSNSTNSIVYYEGSK SGAAAAGFILLSMINLVWVIYFGGDNASPTNRWIDSFSLRGIRPSVLETSMAIARSQRLP VKPSYPYQYQEDLRSASLPDVHHDDEGEGHSGNMYAPELQSSTKYVSSTVLNGFENTDHS SSKPNLDVNAQNTATLNTQATGTFITDTTNANTDTTMGDTLGLYSDIGEELNSFPYTAEA LYTYQADQTDAYEISFEQGEILRVGDIEGRWWKAKKSNGETGIIPSNYVKLLDGKSH
Uniprot No.

Target Background

Function
Recombinant Kluyveromyces lactis High osmolarity signaling protein SHO1 (SHO1) is a plasma membrane osmosensor that activates the high osmolarity glycerol (HOG) MAPK signaling pathway in response to high osmolarity.
Database Links
Protein Families
SHO1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Kluyveromyces lactis SHO1 and what is its function in yeast cells?

Kluyveromyces lactis SHO1 (KlSho1p) is a transmembrane protein that functions as a component of the SHO1 branch in the High Osmolarity Glycerol (HOG) pathway. This protein plays a crucial role in sensing and transmitting signals in response to hyperosmotic stress. The HOG pathway in K. lactis has two main branches - SHO1 and SLN1 - both of which converge to activate the mitogen-activated protein kinase (MAPK) KlHog1 protein .

When K. lactis cells experience hyperosmotic conditions, the SHO1 branch, which includes proteins such as KlSho1p, KlSte20p, KlSte11p, and KlSte50p, initiates a signaling cascade that ultimately leads to KlHog1p phosphorylation and nuclear translocation. This activation enables the cell to mount an appropriate adaptive response to the osmotic challenge .

How does the structure of K. lactis SHO1 compare to its homolog in Saccharomyces cerevisiae?

While the search results don't provide specific structural details comparing K. lactis SHO1 to its S. cerevisiae homolog, functional studies suggest similarities with some notable differences. Both proteins serve as components of the SHO1 branch in their respective HOG pathways, but their importance within the osmosensing network appears to differ.

What are the key differences between the SHO1 and SLN1 branches of the HOG pathway in K. lactis?

The HOG pathway in K. lactis consists of two parallel branches - SHO1 and SLN1 - that respond to hyperosmotic stress:

  • SHO1 Branch Components:

    • Includes the transmembrane protein KlSho1p

    • The PAK kinase KlSte20p

    • The MAPKKK KlSte11p

    • The adaptor protein KlSte50p

  • SLN1 Branch:

    • Includes the MAPKKK KlSsk2p

    • Functions as a phosphorelay system

Key differences include:

  • Redundancy: Single mutants affected in only one branch (except for Δklste11 and Δklste50) can cope with external hyperosmolarity, indicating partial redundancy between the pathways .

  • Essential components: While KlSho1p and KlSte20p are dispensable for osmotic stress response (as long as the SLN1 branch is functional), KlSte11p plays an essential role even when the SLN1 branch is intact, suggesting it may be a point of convergence between the branches .

  • Sensitivity patterns: Deletion of components in both branches (Δklsho1 Δklssk2) produces sensitivity to high osmolarity, similar to what is observed in S. cerevisiae .

What are the preferred vector systems for expressing recombinant SHO1 in K. lactis?

While the search results don't specifically address vectors for SHO1 expression, they provide information about successful expression systems in K. lactis that could be applied to SHO1:

  • Multi-copy vectors based on the 2μ-like plasmid pKD1: These vectors, derived from Kluyveromyces drosophilarum, have been successfully used for high-level secretion of recombinant human proteins, such as interleukin-1 beta (reIL-1 beta) .

  • pKLAC1-based vectors: These vectors have been successfully employed for the expression of recombinant proteins in K. lactis. As demonstrated in the expression of manganese peroxidases, these vectors can be used to create recombinant K. lactis strains with the gene of interest .

For SHO1 expression, researchers should consider:

  • If studying membrane integration: Using the native signal sequence

  • If studying secreted forms: Fusing the SHO1 structural gene in-frame with a synthetic secretion signal, such as one derived from the K. lactis killer toxin

  • Adding appropriate tags (e.g., GST tag) for purification and detection

How can I evaluate the functional activity of recombinant K. lactis SHO1 in osmotic stress response?

To evaluate the functional activity of recombinant K. lactis SHO1 in osmotic stress response, several methodological approaches can be employed:

  • Growth Assays Under Hyperosmotic Conditions:

    • Spot dilution assays on media containing osmotic stressors (e.g., 0.7 M KCl or 1 M sorbitol)

    • Compare growth of wild-type, SHO1 deletion mutants, and strains expressing recombinant SHO1

    • Example parameters based on previous studies: Incubation at 30°C for 48-72 hours

  • KlHog1p Phosphorylation Assessment:

    • Western blot analysis using antibodies specific for phosphorylated MAPK

    • Examine phosphorylation levels after exposure to hyperosmotic conditions (e.g., 0.5 M NaCl)

    • Compare patterns between wild-type and mutant strains

  • Subcellular Localization Studies:

    • Create fluorescent protein fusions with SHO1

    • Observe localization before and after hyperosmotic shock

    • Assess co-localization with other pathway components

  • Complementation Analysis:

    • Express recombinant SHO1 in Δklsho1 Δklssk2 double mutants

    • Test if wild-type phenotype is restored under osmotic stress

    • Compare with controls expressing mutated versions of SHO1

Assessment MethodParametersExpected Results for Functional SHO1Controls
Growth assay0.7 M KCl or 1 M sorbitol media, 30°C, 48-72hGrowth similar to wild-typeΔklsho1, Δklsho1 Δklssk2
Hog1p phosphorylation0.5 M NaCl treatment, 5-30 minIncreased phosphorylationNo treatment, Δklhog1
Nuclear translocationGFP-tagged KlHog1p, 0.5 M NaCl, 5-15 minNuclear accumulationNo treatment
Transcriptional responseqRT-PCR for KlSTL1, 0.5 M NaCl, 30 minIncreased expressionNo treatment, Δklhog1

What methodologies can be used to generate K. lactis SHO1 mutants for structure-function studies?

For generating K. lactis SHO1 mutants to conduct structure-function studies, several methodological approaches can be employed:

  • Site-Directed Mutagenesis:

    • Use PCR-based methods to introduce specific mutations in the SHO1 gene

    • Target conserved domains or residues identified through sequence alignment with homologs

    • Clone the mutated sequences into appropriate K. lactis expression vectors (e.g., pKLAC1-based vectors)

  • Domain Swapping and Chimeric Proteins:

    • Create chimeric proteins by swapping domains between KlSHO1 and ScSHO1

    • For example, create a chimera by adding KlSho1p transmembrane segments to other proteins, similar to the approach used with KlSte11p

    • This approach can help identify the functional importance of specific domains

  • CRISPR-Cas9 Genome Editing:

    • Design guide RNAs targeting the SHO1 locus

    • Introduce specific mutations through homology-directed repair

    • Select transformants and verify mutations by sequencing

  • Deletion and Truncation Analysis:

    • Generate a series of deletion or truncation mutants

    • Express these variants in Δklsho1 backgrounds

    • Assess functional complementation under osmotic stress conditions

  • Structural Computational Analysis:

    • Perform in silico analysis similar to what was conducted for PhcMnp enzyme

    • Use results to guide rational design of mutations

    • Validate computational predictions with experimental data

The functionality of generated mutants should be assessed using the methods described in FAQ 2.2, including growth assays, KlHog1p phosphorylation assessment, and complementation analysis.

How does glycosylation affect the function of recombinant K. lactis SHO1?

While the search results don't directly address glycosylation of KlSHO1, they provide insights about glycosylation effects on other recombinant proteins in K. lactis that may be relevant:

The glycosylation status of recombinant proteins in K. lactis can significantly impact their function, as demonstrated with recombinant human interleukin-1 beta (reIL-1 beta). Unlike its native counterpart, K. lactis-produced reIL-1 beta underwent glycosylation, which resulted in a 95% loss of biological activity. Full restoration of activity was achieved by removing the carbohydrate chains with endo-beta-N-acetyl-glucosamidase H treatment .

For researchers studying recombinant KlSHO1, several considerations apply:

  • Glycosylation Prediction:

    • Analyze the KlSHO1 sequence for potential N-linked glycosylation sites (Asn-X-Ser/Thr motifs)

    • Compare with homologs from other yeast species to identify conserved sites

  • Experimental Assessment:

    • Compare electrophoretic mobility of recombinant KlSHO1 before and after endoglycosidase treatment

    • Use glycoprotein-specific staining methods to detect glycosylation

  • Site-Directed Mutagenesis Approach:

    • Create mutants where potential glycosylation sites are eliminated (e.g., Asn→Gln substitutions)

    • Compare the function of wild-type and glycosylation-deficient variants

    • This approach was successful with IL-1 beta, where an Asn7→Gln7 substitution produced a non-glycosylated variant with full biological activity

If KlSHO1 is found to be glycosylated, researchers should determine whether this modification affects its:

  • Membrane localization

  • Interaction with other pathway components

  • Stability under stress conditions

  • Signaling capacity in the HOG pathway

What role does KlSHO1 play in cross-talk between the HOG pathway and other signaling networks in K. lactis?

Based on the information provided, KlSHO1 likely participates in cross-talk between different signaling pathways in K. lactis, though the search results don't directly address this specific question. Drawing from what is known about the HOG pathway components:

  • Connection with Pheromone Response:

    • KlSte11p and KlSte50p, components of the SHO1 branch, are involved in both the HOG pathway and the pheromone response system

    • These proteins may work as a complex in both pathways, suggesting potential cross-regulation

    • KlSHO1 likely plays a role in maintaining pathway specificity despite shared components

  • Integration with Oxidative Stress Response:

    • There appears to be an interrelationship between mechanisms responding to oxygen availability and oxidative stress in K. lactis

    • MAPK pathways, including potentially the SHO1-containing HOG pathway, may be involved in this integration

    • Research could investigate whether KlSHO1 contributes to this cross-pathway regulation

  • Potential Research Approaches:

    • Generate double mutants lacking components of different pathways along with KlSHO1

    • Assess activation of multiple pathway-specific reporters under various stress conditions

    • Use protein-protein interaction studies to identify KlSHO1 binding partners beyond known HOG pathway components

    • Compare transcriptional responses in wild-type and Δklsho1 mutants when exposed to multiple simultaneous stressors

Understanding this cross-talk could provide insights into how K. lactis coordinates responses to complex environmental challenges that activate multiple signaling pathways simultaneously.

How does the activation mechanism of KlSHO1 differ under various stress conditions beyond hyperosmolarity?

While the search results primarily focus on KlSHO1's role in hyperosmotic stress response, they provide some clues that suggest this protein might respond to other stress conditions as well:

  • Potential Role in Oxidative Stress Response:

    • Search result mentions that redox metabolism is a key differential point between S. cerevisiae and K. lactis

    • The paper describes an interrelationship between mechanisms responding to oxygen availability and oxidative stress

    • This suggests KlSHO1 might be involved in cellular responses to oxidative conditions

  • Experimental Approaches to Investigate Alternative Stress Responses:

    • Comparative Stress Analysis: Expose cells to different stressors (oxidative, pH, temperature, nutrient limitation) and assess KlSHO1-dependent activation of the HOG pathway

    • Reporter Assays: Develop reporter systems that reflect KlSHO1 activity under various stress conditions

    • Phosphorylation Studies: Examine whether KlSHO1 undergoes differential phosphorylation under various stress types

    • Interaction Mapping: Identify stress-specific interaction partners of KlSHO1

  • Potential Differential Activation Mechanisms:

    • Different stressors might induce distinct conformational changes in KlSHO1

    • Stress-specific cofactors might modulate KlSHO1 activity

    • Post-translational modifications might differ depending on the stress type

The unique metabolism of K. lactis, characterized by a higher glucose flow through the pentose phosphate pathway than through glycolysis (compared to S. cerevisiae) , might influence how KlSHO1 and related signaling components respond to different types of cellular stress.

What are the optimal conditions for inducible expression of recombinant SHO1 in K. lactis?

Based on the information provided in the search results, particularly from studies on manganese peroxidase expression in K. lactis , the following approach can be adapted for optimal inducible expression of recombinant SHO1:

  • Growth and Induction Media:

    • Initial cultivation in YEPD (Yeast Extract Peptone Dextrose) liquid medium for biomass accumulation

    • Followed by induction in YEPG (Yeast Extract Peptone Galactose) liquid medium

  • Vector Selection:

    • pKLAC1-based vectors have shown successful expression of recombinant proteins in K. lactis

    • These vectors can be used for integrating the SHO1 gene with appropriate regulatory elements

  • Expression Optimization Parameters:

    • Temperature: Typically 28-30°C for K. lactis cultivation

    • pH: Maintain at optimal range for K. lactis (around pH 5.5-6.0)

    • Induction time: Optimize based on preliminary expression studies (typically 24-72 hours)

    • Aeration: Maintain adequate oxygen levels, as K. lactis is preferentially respiratory

  • Protein Tags and Secretion Signals:

    • For membrane-localized expression: Use native SHO1 signal sequences

    • For secreted variants: Consider fusion with secretion signals like the K. lactis killer toxin "pre" region

    • Add appropriate tags (GST, His, etc.) for detection and purification

    • Position tags to minimize interference with protein function

  • Verification of Expression:

    • Western blot analysis using antibodies against SHO1 or added tags

    • Functional assays to confirm activity (as described in FAQ 2.2)

    • Subcellular localization studies to confirm proper targeting

ParameterRecommended ConditionNotes
Growth phaseYEPD mediumFor biomass accumulation
Induction phaseYEPG mediumGalactose-based induction
Temperature28-30°CStandard for K. lactis growth
Induction time24-72 hoursOptimize based on preliminary tests
pH5.5-6.0Maintain with appropriate buffers
VectorpKLAC1-basedUsed successfully for recombinant expression
Optional tagsN-terminal GST tagFor purification and detection

How can I design experiments to study the interaction between KlSHO1 and other components of the HOG pathway?

To study the interactions between KlSHO1 and other components of the HOG pathway in K. lactis, researchers can employ several experimental approaches:

  • Yeast Two-Hybrid (Y2H) Assays:

    • Clone KlSHO1 and potential interacting partners into appropriate Y2H vectors

    • Test pairwise interactions between KlSHO1 and other HOG pathway components

    • Focus on interactions with KlSte11p, KlSte50p, and KlSte20p, which are known to function in the SHO1 branch

  • Co-Immunoprecipitation (Co-IP) Studies:

    • Generate tagged versions of KlSHO1 and potential partners

    • Perform Co-IP experiments before and after osmotic shock

    • Analyze precipitates by western blotting or mass spectrometry

    • Compare interaction patterns under different stress conditions

  • Bimolecular Fluorescence Complementation (BiFC):

    • Fuse KlSHO1 and potential interacting proteins with complementary fragments of a fluorescent protein

    • Observe fluorescence reconstitution in live cells, indicating protein-protein interaction

    • Monitor dynamics of interactions before and after osmotic stress

  • Domain Mapping Experiments:

    • Create chimeric proteins or domain deletions

    • Test whether specific domains of KlSHO1 are required for interactions

    • Example: The approach used for KlSte11p, where adding KlSho1p transmembrane segments created a functional chimera

  • Genetic Suppression Analysis:

    • Identify mutations in KlSHO1 that suppress phenotypes of mutations in other pathway components

    • Conversely, screen for mutations in other genes that suppress KlSHO1 mutant phenotypes

  • Phosphorylation State Analysis:

    • Investigate how KlSHO1 influences the phosphorylation status of downstream components

    • Compare phosphorylation patterns of KlHog1p in wild-type and Δklsho1 backgrounds

    • This is particularly relevant given the observation that KlHog1p phosphorylation occurs in Δklsho1 Δklssk2 mutants despite their osmosensitivity

Interaction TechniqueAdvantagesLimitationsKey Controls
Yeast Two-HybridDetects direct interactions; ScalablePotential false positives/negatives; Limited to nuclear interactionsEmpty vector controls; Strength-of-interaction controls
Co-ImmunoprecipitationDetects interactions in native context; Can identify complexesMay detect indirect interactionsNon-specific antibody controls; Non-tagged protein controls
BiFCVisualizes interactions in live cells; Detects weak/transient interactionsIrreversible complex formation; Potential artifactsSplit fluorophore alone controls; Localization controls
Domain MappingIdentifies specific interaction regionsLabor-intensive; May disrupt protein foldingFull-length protein controls; Non-interacting domain controls

What methods can be used to investigate the role of KlSHO1 in the unique hyperosmotic stress response of K. lactis compared to S. cerevisiae?

To investigate the role of KlSHO1 in the unique aspects of K. lactis hyperosmotic stress response compared to S. cerevisiae, researchers can employ comparative experimental approaches:

  • Comparative Genetic Complementation:

    • Express K. lactis SHO1 in S. cerevisiae sho1 mutants and vice versa

    • Test complementation under osmotic stress conditions

    • Analyze whether species-specific functions are conserved across species

  • Chimeric Protein Analysis:

    • Create chimeric proteins containing domains from both K. lactis and S. cerevisiae SHO1

    • Express in both yeast species and assess functionality

    • Identify domains responsible for species-specific functions

  • Comparative Signaling Dynamics:

    • Monitor KlHog1p phosphorylation kinetics in response to osmotic stress

    • Compare with S. cerevisiae Hog1p phosphorylation patterns

    • Investigate the role of KlSHO1 in these potentially different kinetics

    • This is particularly relevant given the observation that KlHog1p becomes phosphorylated in Δklsho1 Δklssk2 mutants, which exhibit sensitivity to hyperosmotic stress

  • Transcriptional Response Analysis:

    • Perform RNA-Seq or qRT-PCR analysis of osmotic stress response genes

    • Compare transcriptional profiles between wild-type and Δklsho1 mutants

    • Include analysis of key genes like KlSTL1, which failed to be induced in the Δklste11 Δklssk2 double mutant despite KlHog1p phosphorylation and nuclear internalization

  • Metabolic Integration Studies:

    • Investigate how the distinct metabolic characteristics of K. lactis influence osmotic stress signaling

    • Focus on the higher glucose flow through the pentose phosphate pathway (PPP) in K. lactis

    • Examine how this metabolic difference might affect KlSHO1-dependent signaling

  • Comparative Protein-Protein Interaction Mapping:

    • Perform systematic interactome analysis for KlSHO1 and ScSHO1

    • Identify species-specific interaction partners

    • Focus on interactions that might explain functional differences

Comparative AspectK. lactis ObservationS. cerevisiae ComparisonExperimental Approach
Δsho1 phenotypeNormal growth under high osmolarityNormal growth under high osmolarityGrowth assays with varying osmolyte concentrations
Δste11 phenotypeSensitive to hyperosmotic stress despite intact SLN1 branchNot sensitive unless SLN1 branch is also inactivatedCross-species complementation with STE11
Hog1 phosphorylationOccurs in Δklsho1 Δklssk2 mutants despite osmosensitivityRequires at least one functional branchComparative phosphorylation studies with branch-specific mutants
Transcriptional responseKlSTL1 not induced in certain mutants despite Hog1 phosphorylationTypically correlates with Hog1 phosphorylationTranscriptomic analysis of HOG-responsive genes
Metabolic contextHigher PPP flux than glycolysisHigher glycolytic flux than PPPIntegration of metabolomic data with signaling pathway analysis

What are the unresolved questions about KlSHO1's role in the unique "alternative input" to the HOG pathway in K. lactis?

Search result reveals a fascinating phenomenon where KlHog1p becomes phosphorylated in K. lactis mutants lacking both the SHO1 and SLN1 branches (Δklsho1 Δklssk2), suggesting an alternative input to the HOG pathway. This presents several unresolved questions for future research:

  • Nature of the Alternative Input:

    • What is the molecular identity of this alternative input that can activate KlPbs2p in the absence of the canonical SHO1 and SLN1 branches?

    • Does it represent a third osmosensing branch unique to K. lactis or a bypass mechanism?

    • How is this input activated specifically under high-osmotic-stress conditions?

  • Role of KlSHO1 in Regulating the Alternative Input:

    • Does KlSHO1 normally inhibit this alternative input?

    • How does the presence/absence of KlSHO1 affect the activation threshold of this alternative pathway?

    • What structural features of KlSHO1 might be involved in this regulation?

  • Experimental Approaches for Investigation:

    • Suppressor Screens: Identify mutations that restore osmoresistance to Δklsho1 Δklssk2 mutants

    • Phosphoproteomic Analysis: Compare phosphorylation patterns in wild-type, Δklsho1, and Δklsho1 Δklssk2 strains under osmotic stress

    • Comparative Genomics: Identify candidate genes present in K. lactis but absent in S. cerevisiae that might contribute to this alternative input

    • Synthetic Genetic Arrays: Identify genetic interactions with KlSHO1 that might reveal components of the alternative input

  • Functional Significance:

    • Why does KlHog1p phosphorylation in Δklsho1 Δklssk2 mutants fail to induce transcription of KlSTL1 or enable growth under high osmolarity ?

    • Is the phosphorylation pattern or subcellular localization of KlHog1p qualitatively different when activated through this alternative input?

    • Could this represent a regulatory mechanism to fine-tune osmotic stress responses?

How might the study of KlSHO1 contribute to understanding the evolution of stress response pathways in different yeast species?

The study of KlSHO1 offers unique opportunities to understand the evolution of stress response pathways across yeast species:

  • Evolutionary Conservation and Divergence:

    • K. lactis and S. cerevisiae diverged approximately 150 million years ago

    • Comparing SHO1 structure and function between these species provides insights into conserved core functions versus adaptable features

    • The observation that KlSte11p is essential for osmoresistance even with an intact SLN1 branch (unlike in S. cerevisiae) suggests evolutionary rewiring of pathway architecture

  • Adaptation to Ecological Niches:

    • K. lactis is naturally adapted to dairy environments, while S. cerevisiae is associated with fruit fermentation

    • Differences in SHO1 function may reflect adaptation to distinct osmotic challenges in these environments

    • The unique metabolic profile of K. lactis, with higher pentose phosphate pathway activity , may have co-evolved with signaling adaptations

  • Pathway Redundancy and Robustness:

    • The discovery of an alternative input to the HOG pathway in K. lactis raises questions about evolutionary strategies for signaling robustness

    • Does this represent an ancestral mechanism lost in some lineages or a derived feature in K. lactis?

    • How does pathway redundancy evolve and what role does SHO1 play in this process?

  • Research Approaches:

    • Phylogenetic Analysis: Reconstruct the evolutionary history of SHO1 and related pathway components across yeast species

    • Comparative Functional Studies: Express SHO1 from various yeast species in K. lactis and S. cerevisiae deletion backgrounds

    • Domain Swap Experiments: Identify which domains contribute to species-specific functions through chimeric proteins

    • Whole Pathway Reconstruction: Transfer entire pathway modules between species to test functional conservation

  • Theoretical Frameworks:

    • Investigate whether differences in SHO1 function align with theories of network evolution, such as:

      • Neutral theory of network evolution

      • Selection for increased robustness

      • Adaptation to specific environmental challenges

Understanding the evolutionary trajectory of KlSHO1 may provide insights into general principles governing the evolution of signaling pathways and how organisms adapt their stress responses to specific environmental conditions.

What potential applications exist for engineered K. lactis SHO1 variants in biotechnology?

While the search results don't directly address biotechnological applications of KlSHO1, they provide insights that can inform potential applications:

  • Stress-Resistant Production Strains:

    • Engineered KlSHO1 variants could enhance osmotolerance in K. lactis strains used for biotechnological applications

    • This could be particularly valuable given that K. lactis is food-safe and suitable for application in food or feed industries

    • Modified KlSHO1 could potentially improve production yields under challenging fermentation conditions

  • Biosensor Development:

    • Create reporters linked to KlSHO1-dependent signaling for detecting osmotic stress

    • Develop whole-cell biosensors using engineered K. lactis strains for environmental monitoring

    • These biosensors could leverage the finding that KlHog1p phosphorylation and nuclear translocation occur in response to specific conditions

  • Optimized Heterologous Protein Production:

    • Modulate KlSHO1 to enhance cell survival during recombinant protein production

    • Improve yields of valuable proteins by engineering stress response pathways

    • This builds on K. lactis's established use as a host for high-level secretion of correctly processed recombinant human proteins

  • Metabolic Engineering Applications:

    • Exploit the unique metabolic characteristics of K. lactis, such as its higher glucose flow through the pentose phosphate pathway

    • Engineer KlSHO1 to modulate stress responses in ways that favor desired metabolic outputs

    • Create strains with optimized redox balance for specific biotechnological processes

  • Synthetic Biology Tools:

    • Develop KlSHO1-based switchable genetic circuits responsive to environmental conditions

    • Create modules for stress-dependent regulation of gene expression

    • Design orthogonal signaling pathways with modified KlSHO1 variants that respond to novel inputs

Application AreaPotential ApproachAdvantages of K. lactis Platform
Protein productionEngineer KlSHO1 for enhanced stress toleranceFood-grade host; high secretion capacity
BiosensingDevelop KlSHO1-based stress sensorsClearly defined signaling outputs; non-pathogenic host
Metabolic engineeringModulate KlSHO1 to favor desired metabolic pathwaysUnique metabolic profile with high PPP activity
Food/feed applicationsCreate stress-resistant production strainsFood-safe status; established in biotechnology
Synthetic biologyBuild KlSHO1-based genetic switchesWell-characterized signaling pathway; genetic tractability

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.