Recombinant Kluyveromyces lactis Mitochondrial distribution and morphology protein 32 (MDM32)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If a specific tag is required, please inform us, and we will prioritize its development.
Synonyms
MDM32; KLLA0C06468g; Mitochondrial distribution and morphology protein 32
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
44-583
Protein Length
Full Length of Mature Protein
Species
Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)
Target Names
MDM32
Target Protein Sequence
ATEKHDMDELNKSTDYMHIQNILLQKEKELSTKHTLLKEATGFYDRFKINTKWFLIRGNR PFSFDELSTLFSWLIISQIIWVILGTTTFVSLVLFTFNTVFAKEMVGKFVGNTLNKYIDS CDVEFQDALVPEWKKGCIRFRSVKVRTVTDGKSDVPSDQLQFDLKFNQVDITLSVRKWMT GHGLIDNLTVLGMHGKVVLNDVNENKLVGWFSNPEYHLGAVKVCDSCFTLRDGNQDYRIS IYNMDMNRLRFEWCVSDFFNANVVTGAINHSLFTIHKRQHKLAYLQDLEKDLSPWKRITR LRLDRISVKDLGLDKSSSFNWIEEGSVEIIADLMLPNVEDESQDSDEEKNNKYMVMDLKF NFRDLKAKFPESAPTLSNGETVISFDELKPIINYINNRRVIFNSVATTETIDPDWNRITP VSIKRQKSYPDTTVIPTSVTWPDGEDEVQINKEIIKYHDQPTTNTNNLILKCRIVKNIDE LQNVALFRESGVYDVLAMELYVDLMKIVEEWEFKKKNSWMRLWGTTLASQLLIFGLGAMV
Uniprot No.

Target Background

Function

Recombinant Kluyveromyces lactis Mitochondrial distribution and morphology protein 32 (MDM32) plays a crucial role in mitochondrial membrane organization and overall mitochondrial architecture. It is essential for mitochondrial distribution, mobility, and the maintenance of mitochondrial DNA nucleoid structures.

Database Links
Protein Families
MDM31/MDM32 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MDM32 and what is its role in mitochondrial biology?

MDM32 encodes a mitochondrial inner membrane protein essential for maintaining normal mitochondrial distribution and morphology. Initially characterized in Saccharomyces cerevisiae, this protein functions within distinct protein complexes in the mitochondrial inner membrane. The absence of Mdm32 leads to dramatic morphological changes, including the formation of giant spherical mitochondria with highly aberrant internal structure. Research demonstrates that Mdm32 plays critical roles in mitochondrial DNA (mtDNA) stability, proper organization of mtDNA nucleoids, and maintenance of mitochondrial motility .

Unlike mere structural components, Mdm32 appears to function upstream of mitochondrial fusion and division processes, as evidenced by epistasis experiments showing that Δmdm32 mutations are epistatic to mutations in fusion (Δfzo1) and division (Δdnm1, Δmdm33) genes. This indicates that Mdm32's function is hierarchically superior to these processes in the maintenance of mitochondrial morphology .

How does MDM32 differ between Saccharomyces cerevisiae and Kluyveromyces lactis?

While the search results primarily characterize MDM32 in S. cerevisiae, understanding its function in K. lactis requires comparative analysis. Both yeasts are phylogenetically related, but K. lactis has gained special attention as a food-grade expression system . The functional conservation of mitochondrial morphology proteins between these species warrants investigation, especially considering K. lactis' growing importance in recombinant protein expression.

What phenotypes are associated with MDM32 deletion in yeast cells?

Deletion of MDM32 produces several distinct phenotypes:

  • Altered mitochondrial morphology: Mutants display giant spherical mitochondria instead of the normal branched tubular networks. These abnormal mitochondria often contain small hollow inclusions observable by both fluorescence and electron microscopy .

  • Disrupted internal ultrastructure: Electron microscopy reveals that mitochondria in Δmdm32 mutants are largely devoid of cristae. Instead, they contain circular-shaped double membrane structures inside the organelles, with spacing between membranes corresponding to the intermembrane space .

  • Mitochondrial motility defects: Time-lapse microscopy demonstrates that mutant mitochondria are almost immotile, hardly changing their positions over periods of 15-30 minutes. This immobility results in frequent mitochondrial inheritance defects, with many buds completely lacking mitochondria .

  • mtDNA instability: Approximately 50% of Δmdm32 cells become respiratory-deficient after just 3 days of growth in glucose-containing medium, indicating progressive loss of functional mtDNA .

  • Temperature-sensitive growth defects: Mutants show moderate growth defects under most conditions, with more severe deficiencies on non-fermentable carbon sources at elevated temperatures .

What are the optimal approaches for recombinant expression of MDM32 in Kluyveromyces lactis?

Based on successful recombinant protein expression systems in K. lactis, a methodological approach for MDM32 expression would involve:

  • Vector selection: The pKLAC1 vector system has proven effective for recombinant protein expression in K. lactis. This vector contains necessary elements for stable integration into the K. lactis genome and inducible expression .

  • Gene cloning strategy: The MDM32 gene can be amplified using PCR with primers containing appropriate restriction sites for subsequent cloning into the expression vector. Verification of the construct should include restriction enzyme digestion and DNA sequencing .

  • Transformation protocol: Recombinant plasmids can be transferred into K. lactis GG799 host cells using established transformation protocols, with transformants selected and verified by PCR amplification .

  • Expression conditions: Inducible expression can be achieved by first cultivating recombinant strains in YEPD liquid medium for biomass accumulation, followed by transfer to YEPG liquid medium for induction of protein expression .

  • Protein verification: Expression of recombinant Mdm32 can be verified using techniques such as SDS-PAGE, Western blotting, and activity assays appropriate to the protein's function .

What methods are most effective for analyzing mitochondrial morphology in MDM32 mutants?

Research on MDM32 has employed several complementary techniques to thoroughly characterize mitochondrial morphology:

How can researchers assess mtDNA stability and nucleoid organization in cells expressing recombinant MDM32?

Several methodological approaches can be employed to evaluate mtDNA stability and nucleoid organization:

  • Respiratory competence assay: Cells grown in glucose-containing medium can be periodically sampled and plated onto glucose-containing medium, then replica-plated onto glycerol-containing medium. The percentage of colonies able to grow on glycerol provides a quantitative measure of respiratory competence and, indirectly, mtDNA stability .

  • DAPI staining: This fluorescent DNA stain allows visualization of both nuclear and mitochondrial DNA. In wild-type cells, mtDNA appears as multiple small, punctate nucleoids distributed throughout the mitochondrial network. In MDM32 mutants, this pattern is disrupted .

  • Fluorescence microscopy of labeled nucleoid components: Proteins known to associate with mtDNA, such as Abf2, can be tagged with fluorescent markers to observe nucleoid organization in vivo .

  • Colocalization analysis: Dual-labeling of mtDNA and mitochondrial membrane proteins allows assessment of the spatial relationship between nucleoids and membrane structures, which is often disrupted in MDM32 mutants .

  • Quantitative PCR: This technique can measure mtDNA copy number relative to nuclear DNA, providing quantitative data on mtDNA stability over time or across different genetic backgrounds.

How does MDM32 interact with other mitochondrial morphology maintenance proteins?

MDM32 has critical functional relationships with several other proteins involved in mitochondrial morphology:

  • Synthetic lethality relationships: Deletion of MDM32 is synthetically lethal with deletion of MMM1, MMM2, MDM10, or MDM12 genes. This genetic interaction indicates that Mdm32 functions in a pathway parallel to these outer membrane proteins in maintaining mitochondrial morphology and mtDNA .

  • Functional hierarchy: Epistasis experiments with fusion and division mutants (Δfzo1, Δdnm1, and Δmdm33) reveal that Δmdm32 is epistatic to these mutations. When both MDM32 and any of these genes are deleted, the resulting mitochondrial morphology is indistinguishable from the Δmdm32 single mutant. This indicates that Mdm32 functions upstream of or is prerequisite for the action of these fusion and division proteins .

  • Nucleoid organization connection: While Mdm32 does not directly affect the steady-state levels of Mmm1, Mmm2, or Mdm10 proteins, it is required for the proper association of Mmm1-containing complexes with mtDNA nucleoids. This suggests that Mdm32 might provide a functional link between matrix-localized nucleoids and the outer membrane segregation machinery .

Table 1: Genetic Interactions of MDM32 with Other Mitochondrial Morphology Genes

Gene DeletionCombined with Δmdm32Phenotypic OutcomeInterpretation
Δmmm1Synthetic lethalityCells inviableParallel/redundant functions
Δmmm2Synthetic lethalityCells inviableParallel/redundant functions
Δmdm10Synthetic lethalityCells inviableParallel/redundant functions
Δmdm12Synthetic lethalityCells inviableParallel/redundant functions
Δfzo1ViableΔmdm32-like morphologyΔmdm32 epistatic to Δfzo1
Δdnm1ViableΔmdm32-like morphologyΔmdm32 epistatic to Δdnm1
Δmdm33ViableΔmdm32-like morphologyΔmdm32 epistatic to Δmdm33

What is the current understanding of how MDM32 contributes to mtDNA nucleoid organization?

The relationship between Mdm32 and mtDNA nucleoid organization appears complex:

  • Nucleoid integrity: In cells lacking Mdm32, mtDNA nucleoids become disorganized, similar to the phenotype observed in Δmmm1, Δmmm2, Δmdm10, and Δmdm12 mutants .

  • Mmm1-nucleoid association: While Mmm1 (an outer membrane protein) forms foci in both wild-type and Δmdm32 mutant cells, these foci fail to properly associate with mtDNA nucleoids in the absence of Mdm32. This suggests that Mdm32 may be part of a system that connects matrix-localized nucleoids to outer membrane components .

  • Progressive mtDNA loss: The gradual loss of respiratory competence in Δmdm32 cultures suggests that Mdm32 is required for proper inheritance and maintenance of mtDNA over multiple generations .

  • Inner membrane connection: As an inner membrane protein, Mdm32 may provide a crucial link between the matrix-localized mtDNA and the outer membrane segregation machinery, which includes Mmm1, Mmm2, Mdm10, and Mdm12 .

What are the key challenges in expressing functional recombinant MDM32 in Kluyveromyces lactis?

Based on experiences with recombinant protein expression in K. lactis, several challenges might be anticipated when expressing MDM32:

  • Protein localization: As a mitochondrial inner membrane protein, proper targeting and insertion of recombinant Mdm32 requires appropriate signal sequences and potentially the inclusion of a tag that doesn't interfere with localization .

  • Expression level optimization: Balancing protein expression levels is crucial, as overexpression of membrane proteins can lead to misfolding, aggregation, or cellular toxicity .

  • Functional verification: Unlike enzymes such as manganese peroxidases, which can be assayed directly for activity, functional verification of Mdm32 requires assessment of mitochondrial morphology and mtDNA stability .

  • Construct design: Similar to the successful expression of manganese peroxidases, construction of MDM32 expression cassettes would require careful selection of promoters, signal sequences, and possibly fusion tags for detection and purification .

How can phenotypic discrepancies in MDM32 studies be reconciled in the literature?

Research on mitochondrial morphology proteins occasionally produces seemingly contradictory results. Several approaches can help reconcile these discrepancies:

  • Strain background considerations: Differences in yeast genetic backgrounds can significantly influence mitochondrial phenotypes. When comparing studies, researchers should consider whether S. cerevisiae or K. lactis was used, and which specific strain background was employed .

  • Growth conditions impact: Mitochondrial morphology is highly responsive to growth conditions, including carbon source, growth phase, and temperature. Standardizing or explicitly defining these conditions is essential for reproducible results .

  • Methodology differences: Various techniques for visualizing mitochondria (fluorescence microscopy vs. electron microscopy) may emphasize different aspects of mitochondrial morphology and can lead to different interpretations .

  • Time-dependent phenotypes: The progressive loss of mtDNA in MDM32 mutants indicates that phenotypes may change over time or generations, potentially accounting for differences between studies examining cells at different time points .

What techniques enable the study of MDM32 dynamics and interactions in living cells?

Advanced methodologies for studying Mdm32 dynamics include:

How conserved is MDM32 function across different yeast species and model organisms?

Understanding the evolutionary conservation of MDM32 provides insights into its fundamental role:

  • Comparative genomics: While detailed in S. cerevisiae, Mdm32 homologs exist in other fungi, including K. lactis. The degree of sequence conservation can provide insights into functionally critical domains.

  • Functional complementation experiments: Testing whether MDM32 from one species can rescue phenotypes in another species can reveal functional conservation despite sequence divergence.

  • Structural conservation: Despite potential sequence differences, structural conservation of Mdm32 across species would suggest preserved functional mechanisms.

The ability to express S. cerevisiae Mdm32 in K. lactis could provide an experimental system to test functional conservation directly, while simultaneously developing a recombinant expression system for this important protein .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.