Recombinant Kluyveromyces lactis Mitochondrial import inner membrane translocase subunit TIM14 (PAM18)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PAM18; TIM14; KLLA0E09438g; Mitochondrial import inner membrane translocase subunit TIM14; Presequence translocated-associated motor subunit PAM18
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-163
Protein Length
full length protein
Species
Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)
Target Names
PAM18
Target Protein Sequence
MAQQNIEVPQLPIPGEDNSNRVPEQVVIGHPAAGVPPIPQQKSGMDLYFDQALDYMGDHP VLTGVGGFFALYFAAGAYKSVSKRLGGSSQGVKYLKGGFDPKMNAKEALAILNLNETNLS KKKLKEVHRRIMLANHPDKGGSPYLATKINEAKDFLEKKVVRK
Uniprot No.

Target Background

Function
An essential component of the PAM complex, this protein is crucial for the ATP-dependent translocation of transit peptide-containing proteins from the inner mitochondrial membrane into the matrix. Within the complex, it plays a vital role in stimulating the activity of mtHSP70 (SSC1).
Database Links
Protein Families
TIM14 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is TIM14/PAM18 and what role does it play in mitochondrial function?

TIM14/PAM18 is a crucial component of the mitochondrial protein import machinery, specifically as part of the import motor of the TIM23 complex. This protein functions as a key element in the presequence translocase-associated motor (PAM) complex that facilitates the translocation of nuclear-encoded proteins into mitochondria. The TIM14/PAM18 protein specifically participates in the ATP-dependent step of protein translocation into the mitochondrial matrix. It interacts directly with other components of the import motor to ensure efficient protein import, which is essential for maintaining proper mitochondrial function and homeostasis. TIM14/PAM18 is particularly important for driving presequence precursor translocation to the matrix, working in concert with ATP-dependent chaperones .

How can recombinant K. lactis TIM14/PAM18 be expressed and purified?

Recombinant K. lactis TIM14/PAM18 can be successfully expressed in prokaryotic systems, particularly in E. coli expression hosts. The recommended methodology involves:

  • Cloning Strategy: The full-length coding sequence (1-163 amino acids) is typically cloned into an expression vector with an N-terminal His-tag for affinity purification.

  • Expression Conditions: After transformation into an appropriate E. coli strain, expression is induced under optimized conditions (temperature, inducer concentration, duration).

  • Purification Protocol: The expressed protein can be purified using nickel affinity chromatography, taking advantage of the His-tag. Following purification, the protein typically achieves >90% purity as assessed by SDS-PAGE.

  • Storage Formulation: The purified protein is often lyophilized in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0. For long-term storage, it's recommended to reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL and add glycerol to a final concentration of 5-50% before storing at -20°C or -80°C .

  • Handling Precautions: Repeated freeze-thaw cycles should be avoided to maintain protein integrity. Working aliquots can be stored at 4°C for up to one week .

This expression system allows for the production of significant quantities of functional protein suitable for various biochemical and structural studies.

How does TIM14/PAM18 interact with other components of the mitochondrial import machinery?

TIM14/PAM18 functions as part of an intricate network of protein interactions within the mitochondrial import machinery. It specifically interacts with other components of the TIM23 complex and the associated import motor. The interactions include:

  • Association with TIM23 Complex: TIM14/PAM18 associates with the core TIM23 complex, which forms the channel through which presequence-containing proteins are translocated across the inner mitochondrial membrane. The TIM23 complex forms supercomplexes with respiratory complexes III and IV and the ADP/ATP carrier, which facilitates protein import under energy-limiting conditions .

  • Functional Interaction with PAM Components: Within the import motor, TIM14/PAM18 works in concert with other PAM components to drive ATP-dependent translocation of precursor proteins into the matrix.

  • Regulatory Interactions: The activity of TIM14/PAM18 is influenced by the energetic state of mitochondria, including membrane potential (Δψ) and ATP levels. Both the translocation of precursor proteins through the TIM23 complex and the TIM22 complex require the Δψ, highlighting the importance of bioenergetic coupling .

What methodological approaches are optimal for studying TIM14/PAM18 function in vitro?

Studying TIM14/PAM18 function in vitro requires a combination of biochemical, biophysical, and structural approaches:

  • Reconstitution Systems: Purified recombinant TIM14/PAM18 can be incorporated into liposomes or nanodiscs to reconstitute aspects of the import machinery for functional studies. This approach allows for the systematic analysis of protein-protein interactions and mechanistic studies of the import process.

  • Protein-Protein Interaction Assays: Techniques such as co-immunoprecipitation, pull-down assays, and surface plasmon resonance can be employed to study the interactions between TIM14/PAM18 and other components of the import machinery.

  • Import Assays: In vitro import assays using isolated mitochondria or reconstituted systems can be used to assess the functional contribution of TIM14/PAM18 to protein translocation. These assays typically involve the use of radiolabeled or fluorescently labeled precursor proteins.

  • Structural Studies: X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy can be used to determine the structure of TIM14/PAM18 alone or in complex with interacting partners. The availability of recombinant protein with high purity (>90%) makes these approaches feasible .

  • Site-Directed Mutagenesis: Systematic mutation of key residues in TIM14/PAM18 can provide insights into structure-function relationships. The effects of these mutations can be assessed using the functional assays described above.

When designing these studies, it's important to consider the native context of TIM14/PAM18 as a membrane-associated protein that functions as part of a multi-protein complex in an environment with specific energetic requirements.

How does K. lactis TIM14/PAM18 compare to homologs from other yeast species in structure and function?

K. lactis TIM14/PAM18 shows significant homology with TIM14/PAM18 proteins from other yeast species, but with species-specific variations that may reflect adaptations to different cellular environments:

Comparative Features Table:

SpeciesProtein LengthKey Functional DomainsNotable Differences
K. lactis163 amino acidsMembrane association, PAM complex interactionOptimized for K. lactis mitochondrial environment
S. cerevisiaeSimilarSimilar functional domainsModel system, extensively characterized
Other yeastsVariableConserved core domainsSpecies-specific adaptations

The functional conservation of TIM14/PAM18 across yeast species highlights the evolutionary importance of the mitochondrial protein import machinery. Despite sequence variations, the core functions in facilitating ATP-dependent protein translocation are maintained. Comparative studies can provide insights into the structural elements that are essential for function versus those that can tolerate variation.

K. lactis, specifically, has been developed as a food-grade expression system , making it particularly interesting for studying homologous protein expression. The domestication of K. lactis for biotechnological applications provides additional tools for studying TIM14/PAM18 function in a genetically tractable system.

What is the role of TIM14/PAM18 in mitochondrial stress response and quality control mechanisms?

TIM14/PAM18 plays a significant role in mitochondrial stress response and quality control through its function in the protein import machinery:

  • Sensing Mitochondrial Fitness: The protein import activity, in which TIM14/PAM18 participates, serves as a sensor for mitochondrial fitness and quality. Import activity is determined by the energetic state (membrane potential, ATP levels) and protein homeostasis of mitochondria .

  • Response to Energetic Stress: Under energy-limiting conditions, the interaction of the TIM23 complex (of which TIM14/PAM18 is a component) with respiratory complexes facilitates protein import, representing an adaptive response to stress .

  • Integration with Quality Control: The protein import machinery is integrated with mitochondrial protein quality control systems. Impaired import can trigger responses that help maintain mitochondrial proteostasis.

  • Adaptation to Nutrient Availability: In yeast systems like K. lactis, nutrient availability can influence cellular processes, including those related to mitochondrial function. The RAS-cAMP pathway, which regulates responses to nutrient limitation, may indirectly influence mitochondrial protein import mechanisms .

The study of how TIM14/PAM18 function is modulated under different stress conditions can provide insights into mitochondrial adaptive responses and quality control mechanisms. This is particularly relevant for understanding mitochondrial dysfunction in various pathological conditions.

How can genetic modification strategies be applied to study TIM14/PAM18 in K. lactis?

Genetic modification of K. lactis to study TIM14/PAM18 can leverage several approaches that have been successfully applied in this yeast system:

  • Integration-Based Expression Systems: K. lactis allows for the stable integration of expression constructs into its genome. This approach can be used to express modified versions of TIM14/PAM18 for functional studies. The integration mechanism involves homologous recombination at specific loci, similar to the approach described for expressing other proteins in K. lactis .

  • Promoter Selection: The choice of promoter can significantly influence expression levels and conditions. Inducible promoters, such as those responsive to galactose (similar to the approach used in the YEPG induction system described for other recombinant proteins in K. lactis), can provide temporal control over expression .

  • Tagging Strategies: Fusion of TIM14/PAM18 with epitope tags or fluorescent proteins can facilitate purification, localization studies, and interaction analyses. The N-terminal His-tag approach has been demonstrated to work effectively for purification purposes .

  • CRISPR-Cas9 Genome Editing: Advanced genome editing techniques can be applied to create precise modifications in the endogenous TIM14/PAM18 gene, allowing for the study of specific residues or domains in the native context.

  • Screening Approaches: Mutagenesis screens can identify novel factors influencing TIM14/PAM18 function. Similar approaches have been used in K. lactis to identify factors affecting mating-type switching, demonstrating the feasibility of genetic screens in this organism .

What are the current limitations in studying K. lactis TIM14/PAM18 and how might they be overcome?

Several challenges exist in the study of K. lactis TIM14/PAM18, each requiring specific methodological approaches to overcome:

  • Membrane Protein Challenges: As a component of the mitochondrial inner membrane, TIM14/PAM18 presents typical challenges associated with membrane protein studies, including issues with solubility and maintaining native conformation. These challenges can be addressed through the use of appropriate detergents, nanodiscs, or other membrane mimetics during purification and functional studies.

  • Complex Formation: TIM14/PAM18 functions as part of a multi-protein complex, making it challenging to study in isolation. Approaches such as co-expression of interacting partners or the development of stable subcomplexes can help maintain functional interactions.

  • Dynamic Process: The protein import process is highly dynamic and energy-dependent, making it difficult to capture transient states. Time-resolved structural studies and single-molecule approaches might provide insights into these dynamic aspects.

  • Species-Specific Variations: While K. lactis is a valuable model organism, differences from the more extensively studied S. cerevisiae must be considered. Comparative studies between the two species can help identify conserved mechanisms and species-specific adaptations.

Future methodological advances, including improvements in membrane protein structural biology and the development of more sophisticated reconstitution systems, may help address these limitations and provide deeper insights into TIM14/PAM18 function.

How does the energetic state of mitochondria influence TIM14/PAM18 function?

The function of TIM14/PAM18 is intimately linked to the energetic state of mitochondria through several mechanisms:

  • Membrane Potential Dependence: The translocation of precursor proteins through the TIM23 complex, of which TIM14/PAM18 is a component, requires the mitochondrial membrane potential (Δψ). This energetic parameter directly influences the efficiency of protein import .

  • ATP Requirement: The ATP-dependent steps of protein translocation involve chaperones that work in concert with TIM14/PAM18. The availability of ATP in the mitochondrial matrix therefore directly impacts the function of the import motor .

  • Integration with Respiratory Chain: The TIM23 complex forms supercomplexes with respiratory complexes III and IV as well as with the ADP/ATP carrier. These interactions facilitate protein import under energy-limiting conditions and can also promote the assembly of respiratory complexes .

  • Regulatory Feedback: Impairment of respiratory chain activity, reduction of ATP levels, or accumulation of misfolded proteins in the matrix can directly affect the import-driving activity of translocases like the TIM23 complex .

Research approaches to study these energy-dependent aspects include the use of specific inhibitors of respiratory chain complexes, ATP synthesis, or uncouplers of the membrane potential, combined with assays for protein import efficiency.

What experimental designs are most effective for analyzing TIM14/PAM18 interactions with substrate proteins?

To effectively analyze TIM14/PAM18 interactions with substrate proteins during the import process, several experimental approaches can be employed:

  • Crosslinking Studies: Chemical crosslinking followed by mass spectrometry can capture transient interactions between TIM14/PAM18 and substrate proteins during the import process. This approach can identify contact sites and provide insights into the spatial arrangement of proteins during translocation.

  • Site-Specific Photocrosslinking: Introduction of photoreactive amino acids at specific positions in either TIM14/PAM18 or substrate proteins can provide more precise information about interaction interfaces.

  • Fluorescence-Based Approaches: Fluorescence resonance energy transfer (FRET) between labeled TIM14/PAM18 and substrate proteins can be used to monitor interactions in real-time and under various conditions.

  • Reconstituted Systems: Development of minimally reconstituted systems containing purified TIM14/PAM18 and other essential components of the import machinery can allow for controlled studies of substrate interactions.

  • Structural Studies of Complexes: Cryo-electron microscopy of TIM14/PAM18 in complex with substrate proteins can provide structural insights into the interaction mechanism.

How can studies on K. lactis TIM14/PAM18 contribute to understanding mitochondrial diseases?

Research on K. lactis TIM14/PAM18 can provide valuable insights into mitochondrial diseases through several mechanisms:

By leveraging the genetic tractability of K. lactis and the advanced tools available for studying this organism, researchers can gain fundamental insights that may ultimately contribute to our understanding of human mitochondrial diseases and potential therapeutic approaches.

What biotechnological applications can leverage K. lactis TIM14/PAM18 research findings?

The study of K. lactis TIM14/PAM18 can inform several biotechnological applications:

  • Optimized Recombinant Protein Production: K. lactis is already used as a food-grade expression system . Understanding the mitochondrial import machinery, including TIM14/PAM18, can potentially lead to improvements in cellular energy metabolism and protein processing, enhancing the efficiency of recombinant protein production.

  • Protein Import Enhancement: Manipulating the expression or activity of TIM14/PAM18 and related components might be used to enhance the import of specific mitochondrially-targeted proteins in biotechnological applications.

  • Biosensor Development: The sensitivity of the protein import machinery to mitochondrial energetic state and stress could potentially be leveraged to develop biosensors for mitochondrial function or cellular stress.

  • Therapeutic Protein Delivery: Insights into the mechanisms of protein translocation across membranes might inform strategies for delivering therapeutic proteins across biological barriers.

  • Metabolic Engineering: The close integration of mitochondrial protein import with energy metabolism suggests that modulation of import pathways, including those involving TIM14/PAM18, might be used in metabolic engineering approaches to enhance production of desired metabolites.

These applications represent potential translational outcomes from basic research on K. lactis TIM14/PAM18 and highlight the importance of fundamental studies for biotechnological innovation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.