Recombinant Kluyveromyces lactis Mitochondrial import inner membrane translocase subunit TIM22 (TIM22)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary by purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag type, please inform us for preferential development.
Synonyms
TIM22; KLLA0D08536g; Mitochondrial import inner membrane translocase subunit TIM22
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-196
Protein Length
full length protein
Species
Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)
Target Names
TIM22
Target Protein Sequence
MVYRGFGLDQVSPPENKPFDQLSPEEQGEKGAQMMVEFMTSCPGKAAISGVTGFALGGVF GLFMASMAYDTPLHTPAPTNAPGLPNKVKELADLPLKQQIKIQFSDMGKRSYSSAKNFGY IGMIYSGVECVVESLRAKNDIYNGVAAGCLTGGGLAYKSGPQAALVGCAGFAAFSTAIDL YMRNENKKPPKDDFDE
Uniprot No.

Target Background

Function

Recombinant Kluyveromyces lactis Mitochondrial Import Inner Membrane Translocase Subunit TIM22 (TIM22): A crucial component of the TIM22 complex, this protein facilitates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. Within the TIM22 complex, it functions as a voltage-activated, signal-gated channel, forming a twin-pore translocase that utilizes the membrane potential as an external driving force in two voltage-dependent steps.

Database Links
Protein Families
Tim17/Tim22/Tim23 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

How does the structure of TIM22 relate to its function in the mitochondrial membrane?

TIM22's structure is directly linked to its channel-forming function. While the precise membrane topology has not been experimentally determined, bioinformatic predictions suggest TIM22 contains four hydrophobic transmembrane (TM) segments: residues 50-69, 81-99, 129-146, and 174-191 . The second predicted segment (residues 81-99) appears less hydrophobic than the others.

The protein contains two highly conserved cysteine residues (Cys-42 and Cys-141) that form an intramolecular disulfide bond critical for stabilizing the TIM22 complex . Based on sequence similarity with the related protein Tim23, the N-terminus of TIM22 likely faces the intermembrane space (IMS) . This structural arrangement enables TIM22 to form a channel through which substrate proteins can be inserted into the inner membrane.

What are the key protein-protein interactions involving TIM22 in the mitochondrial import system?

TIM22 interacts with several proteins to form the functional TIM22 complex:

  • Tim54 and Tim18: These are core subunits of the TIM22 complex that interact directly with TIM22. The oxidized form of TIM22 (with disulfide bond) shows stronger interactions with Tim18 than the reduced form .

  • Small TIM chaperones: The heterohexameric Tim9-Tim10 complex transports carrier proteins from the TOM complex to the TIM22 complex .

  • Tim40/Mia40: This protein drives the import of TIM22 into the intermembrane space through the formation of mixed disulfide intermediates, despite TIM22 lacking typical Cys motifs (like CX₃C or CX₉C) for the Tim40 pathway .

These interactions create a coordinated system for the recognition, chaperoning, and insertion of carrier proteins into the inner mitochondrial membrane.

What expression systems are most effective for producing recombinant K. lactis TIM22?

Escherichia coli is the most commonly used expression system for recombinant K. lactis TIM22 production . When working with this system, consider the following methodology:

  • Vector design: Use vectors with strong promoters (like T7) and appropriate tags (e.g., His-tag) for purification. The His-tag is typically added to the N-terminus to avoid interfering with TIM22's C-terminal membrane insertion signals .

  • Expression conditions: Optimize temperature (typically 18-25°C for membrane proteins), inducer concentration, and expression time to enhance proper folding.

  • Extraction and solubilization: Use mild detergents like DDM (n-dodecyl β-D-maltoside) or digitonin to solubilize TIM22 without denaturation.

  • Purification strategy: Implement IMAC (immobilized metal affinity chromatography) followed by size exclusion chromatography for highest purity.

Remember that membrane proteins like TIM22 can be challenging to express in soluble, correctly folded forms, so optimizing these conditions is crucial for successful production.

How can researchers verify the proper folding and disulfide bond formation in recombinant TIM22?

Several complementary techniques can be used to verify proper folding and disulfide bond formation:

  • SDS-PAGE under reducing vs. non-reducing conditions: Properly folded TIM22 with its intramolecular disulfide bond will migrate faster under non-reducing conditions compared to reducing conditions (with β-mercaptoethanol) .

  • Thiol-trapping assays: Using reagents like AMS (4-acetamido-4'-maleimidylstilbene-2,2'-disulfonic acid) to trap free thiol groups. Properly oxidized TIM22 will show size increase only after DTT pretreatment followed by AMS modification .

  • Mass spectrometry: To precisely determine the presence of disulfide bonds.

  • Circular dichroism (CD) spectroscopy: To assess secondary structure integrity.

  • Functional assays: Testing TIM22's ability to interact with known binding partners like Tim18 can indicate proper folding, as oxidized TIM22 shows stronger interactions with Tim18 than reduced TIM22 .

The results should be compared with controls, such as Tim23 (which contains free thiols) and mutated versions of TIM22 where cysteine residues are replaced with serine (C42S, C141S, C42/141S) .

How do mutations in the conserved cysteine residues affect TIM22 complex stability and function?

Mutations in the conserved cysteine residues (Cys-42 and Cys-141) have significant effects on TIM22 complex stability and function:

  • Thermal stability: While cysteine mutants (C42S, C141S, and C42/141S) show normal protein levels at 30°C, they exhibit decreased stability at elevated temperatures (37°C) .

  • Complex integrity: The disulfide bond between Cys-42 and Cys-141 stabilizes the quaternary structure of the TIM22 complex. In its absence, the complex becomes more "relaxed," facilitating the exchange between newly imported TIM22 and pre-existing TIM22 in the complex .

  • Protein import efficiency: Mutant TIM22 proteins lacking the disulfide bond show altered efficiency in importing substrate proteins into mitochondria.

  • Binding affinity: Wild-type TIM22 with an intact disulfide bond has higher affinity for other TIM22 complex subunits (Tim54 and Tim18) compared to the cysteine mutants .

These findings suggest that the intramolecular disulfide bond in TIM22 is critical for maintaining the structural integrity of the TIM22 complex under stress conditions, rather than being essential for basic assembly.

What are the evolutionary implications of TIM22 complex structure across different species?

The TIM22 complex shows remarkable evolutionary divergence while maintaining functional conservation:

  • Independent subunit accretion: Animals and fungi have independently acquired different subunits for their TIM22 complexes over evolutionary time .

  • Neutral structural divergence: Despite structural differences, the TIM22 complex maintains strong functional conservation across vast phylogenetic spans. This suggests that many differences in complex composition are non-adaptive .

  • Functional constraints: The need to physically interact with numerous substrate proteins constrains the functional divergence of the TIM22 complex .

  • Theoretical framework: The evolution of the TIM22 complex aligns with the theory of effectively neutral divergence of mean phenotypes across major phylogenetic lineages. This theory posits that selective pressures on functionally conserved molecular machines have remained relatively constant over long evolutionary periods .

How does TIM22 contribute to mitochondrial disease pathology?

While direct mutations in TIM22 have not been extensively characterized in mitochondrial diseases, disruptions in the protein import machinery can have significant pathological consequences:

  • Import clogging: Amino acid substitutions in substrate proteins can disrupt traffic into mitochondria, leading to a phenomenon called "import clogging" .

  • Systemic effects: Since TIM22 is responsible for inserting numerous carrier proteins into the inner membrane, dysfunction can affect multiple mitochondrial processes, including energy production, metabolite transport, and protein homeostasis.

  • Stress sensitivity: As demonstrated with cysteine mutants, compromised TIM22 function particularly affects cells under stress conditions (e.g., elevated temperatures) .

  • Cell-type specific manifestations: Given the varied energy demands of different tissues, TIM22 dysfunction may manifest differently across cell types, potentially explaining the tissue-specific nature of many mitochondrial disorders.

Research into the relationship between TIM22 and disease is still developing, but understanding its function provides insight into potential therapeutic targets for mitochondrial disorders.

What are the most effective assays for studying TIM22-dependent protein import in mitochondria?

Several complementary assays can be employed to study TIM22-dependent protein import:

  • In vitro import assays: Using isolated mitochondria and radiolabeled substrate proteins.

    • Methodology: Incubate isolated mitochondria with ³⁵S-labeled substrate proteins (typically carrier proteins) in import buffer containing ATP and appropriate membrane potential.

    • Analysis: Track import by SDS-PAGE and autoradiography, with protease protection assays to confirm proper insertion.

  • Blue Native PAGE analysis: To study the integrity of the TIM22 complex.

    • Methodology: Solubilize mitochondria with mild detergents (digitonin) and separate protein complexes by BN-PAGE.

    • Analysis: Detect TIM22 complex by immunoblotting with antibodies against complex components.

  • Co-immunoprecipitation: To detect interactions between TIM22 and other components.

    • Methodology: Solubilize mitochondria, immunoprecipitate with anti-TIM22 antibodies, and detect interacting partners by immunoblotting.

    • Results: This approach revealed stronger interactions between oxidized TIM22 and Tim18 compared to reduced TIM22 .

  • Split-GFP complementation: For studying protein-protein interactions in vivo.

    • Methodology: Fuse TIM22 and potential interacting partners with complementary GFP fragments; interaction brings fragments together to form fluorescent GFP.

Each method provides different insights into TIM22 function, and combining multiple approaches yields the most comprehensive understanding.

What experimental strategies can resolve conflicting findings about TIM22 disulfide bond formation?

Contradictory findings regarding TIM22 disulfide bond formation can be addressed through these methodological approaches:

  • Time-resolved import studies: Track the oxidation state of newly imported TIM22 over time to determine when disulfide bond formation occurs.

    • Methodology: Pulse-chase experiments with ³⁵S-labeled TIM22 precursor, followed by AMS modification at different time points.

  • Conditional depletion systems: Use temperature-sensitive mutants or regulated promoters to deplete potential oxidation factors.

    • Studies reported that TIM22 disulfide bond formation occurs even when Tim40/Mia40 or Erv1 is depleted, suggesting an alternative oxidation pathway .

  • Membrane potential dependence: Assess disulfide bond formation in the presence of ionophores that dissipate membrane potential.

    • Research suggests that membrane potential (ΔΨ) is essential for TIM22 disulfide bond formation .

  • Assembly-dependent oxidation: Investigate the correlation between complex assembly and disulfide bond formation.

    • Evidence indicates that disulfide bond formation occurs after assembly into the TIM22 complex, as excess TIM22 that cannot incorporate into the complex remains in a reduced state .

  • In vitro reconstitution: Reconstitute the system with purified components to identify the minimal requirements for disulfide bond formation.

These approaches can help resolve whether TIM22 oxidation depends on the general mitochondrial disulfide relay system or occurs through an alternative pathway during complex assembly.

What are the common challenges in reconstituting functional TIM22 complexes in vitro?

Reconstituting functional TIM22 complexes presents several challenges that researchers should anticipate:

  • Maintaining membrane protein solubility: TIM22 and other complex components are membrane proteins that tend to aggregate outside their native environment.

    • Solution: Screen multiple detergents (DDM, digitonin, LMNG) at different concentrations to find optimal solubilization conditions.

  • Achieving proper oxidation state: The disulfide bond in TIM22 is crucial for function.

    • Solution: Consider controlled oxidation using glutathione redox buffers or copper phenanthroline during purification.

  • Assembling multiprotein complexes: The TIM22 complex consists of multiple subunits that must assemble correctly.

    • Solution: Co-expression of multiple subunits or sequential addition in controlled ratios.

  • Functional validation: Confirming that reconstituted complexes are functionally active.

    • Solution: Develop liposome-based transport assays to monitor insertion of substrate proteins.

  • Structural heterogeneity: TIM22 complexes may exist in different conformational states.

    • Solution: Use cryo-EM classification to separate different conformational states.

Each challenge requires specific methodological adjustments, and optimizing reconstitution conditions often requires iterative refinement based on functional and structural characterization.

How can the integrity and functionality of purified recombinant TIM22 be preserved during storage?

Preserving the integrity of purified TIM22 requires careful attention to storage conditions:

  • Buffer optimization:

    • Use Tris/PBS-based buffers at pH 8.0 with 6% trehalose as a stabilizing agent .

    • Include appropriate detergent at concentrations just above the critical micelle concentration.

  • Prevention of freeze-thaw damage:

    • Add 5-50% glycerol (optimal: 50%) as a cryoprotectant before freezing .

    • Aliquot protein solutions to avoid repeated freeze-thaw cycles, which are particularly damaging to membrane proteins .

  • Storage temperature considerations:

    • For long-term storage: -80°C in single-use aliquots.

    • For working solutions: Store at 4°C for up to one week .

  • Reconstitution practices:

    • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL .

    • Centrifuge vials briefly before opening to bring contents to the bottom .

  • Functional validation after storage:

    • Periodically verify protein integrity using techniques like SDS-PAGE under reducing and non-reducing conditions.

    • Test for retained ability to interact with known binding partners.

Following these protocols will maximize the stability and functionality of recombinant TIM22 during storage and handling.

How does K. lactis TIM22 differ from TIM22 in other yeast species like S. cerevisiae?

K. lactis TIM22 shares fundamental functions with S. cerevisiae TIM22 but exhibits several notable differences:

FeatureK. lactis TIM22S. cerevisiae TIM22
Protein length196 amino acids 199 amino acids
Conserved cysteinesCys-42, Cys-141 Equivalent positions conserved
Structural interactionsForms disulfide bond critical for complex stability Similar disulfide bond pattern
Evolutionary contextPart of a lineage with independent subunit accretion Same evolutionary pattern as K. lactis
Special featuresProduced by the same organism that secretes zymocin (unrelated to TIM22 function) No equivalent toxin system

While functionally similar, these differences highlight how the TIM22 complex exemplifies neutral structural divergence across species while maintaining core functions . This comparison provides insights into which features are essential for TIM22 function across species and which are more flexible.

What can we learn from comparing the disulfide bond formation in TIM22 with other mitochondrial proteins?

Comparing TIM22's disulfide bond formation with other mitochondrial proteins reveals important insights:

  • Unique oxidation pathway: Unlike many IMS proteins that require the Erv1-Tim40 disulfide relay system for oxidation, TIM22 can form its disulfide bond even when Tim40 (Mia40) or Erv1 is depleted . This suggests an alternative oxidative folding mechanism.

  • Structural comparison with Tim23: Tim23, another channel-forming protein in mitochondria, contains three cysteine residues but does not form disulfide bonds. In AMS modification assays, Tim23 shows free thiols even without DTT pretreatment, unlike TIM22 .

  • Assembly-dependent oxidation: Evidence suggests TIM22 forms its disulfide bond after assembly into the TIM22 complex, potentially through a mechanism where proper folding within the complex brings cysteine residues into proximity .

  • Membrane potential requirement: TIM22 disulfide bond formation depends on mitochondrial membrane potential (ΔΨ), unlike many other IMS proteins .

  • Evolutionary implications: The conservation of these cysteine residues across species suggests functional importance, yet the oxidation mechanism appears to differ from the canonical mitochondrial disulfide relay system.

This comparison highlights the diversity of oxidative folding pathways within mitochondria and suggests that TIM22 represents a specialized case where disulfide bond formation is integrated with complex assembly rather than occurring as a separate import step.

What are the most promising approaches for resolving the membrane topology of TIM22?

Resolving TIM22's membrane topology is crucial for understanding its mechanism and requires complementary approaches:

  • Cysteine scanning mutagenesis:

    • Methodology: Introduce cysteine residues at various positions in TIM22, then use membrane-impermeable thiol-reactive reagents to determine which cysteines are accessible from which side of the membrane.

    • Significance: This approach can experimentally map the orientation of TIM22's domains relative to the membrane.

  • Protease protection assays:

    • Methodology: Treat mitochondria or mitoplasts (mitochondria with disrupted outer membrane) with proteases, then analyze which regions of TIM22 are protected.

    • Significance: Protected regions are likely embedded in the membrane or facing the matrix.

  • Cryo-electron microscopy:

    • Methodology: Purify the TIM22 complex and determine its structure using cryo-EM.

    • Significance: High-resolution structural data would resolve the long-standing question of whether TIM22 has three or four transmembrane segments .

  • Epitope tagging combined with immunofluorescence:

    • Methodology: Insert epitope tags at various positions in TIM22, then determine their accessibility using antibodies after selective permeabilization of membranes.

    • Significance: This approach can determine which regions face the IMS versus the matrix.

  • Hydrogen-deuterium exchange mass spectrometry:

    • Methodology: Analyze the rate of hydrogen-deuterium exchange in different regions of TIM22 to identify membrane-protected segments.

    • Significance: This technique can provide dynamic information about membrane topology.

Determining TIM22's topology would resolve whether the disulfide bond forms within the IMS or requires insertion of Cys-41 into the membrane to interact with Cys-141 , significantly advancing our understanding of TIM22 complex assembly and function.

How might the function of K. lactis TIM22 be affected by the presence of the K. lactis gamma-toxin system?

The relationship between K. lactis TIM22 and the gamma-toxin system presents an intriguing research direction:

  • Potential regulatory crosstalk:

    • K. lactis secretes a heterotrimeric toxin (zymocin) with a gamma-subunit that targets specific tRNAs, causing growth arrest in sensitive cells .

    • Research question: Does gamma-toxin-induced translational stress affect TIM22 expression or function?

  • Stress response mechanisms:

    • Gamma-toxin cleaves tRNAs containing the modified wobble nucleoside 5-methoxycarbonylmethyl-2-thiouridine (mcm⁵s²U) .

    • Research question: How does this cleavage affect the translation of nuclear-encoded mitochondrial proteins, including TIM22 complex components?

  • Co-evolutionary implications:

    • Research question: Have TIM22 and other mitochondrial import components evolved features to maintain protein import during gamma-toxin activation?

  • Experimental approaches:

    • Analyze TIM22 expression and function in K. lactis strains with active versus inactive gamma-toxin.

    • Examine whether TIM22 mRNA contains features that might protect it from translation inhibition during toxin action.

    • Investigate whether mitochondrial function is preserved differently in K. lactis compared to other yeasts during cellular stress.

This research direction could reveal unique adaptations in K. lactis mitochondrial protein import machinery that have co-evolved with its toxin system, potentially providing insights into stress adaptation mechanisms in eukaryotic cells.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.