Recombinant Kluyveromyces lactis Mitochondrial intermembrane space import and assembly protein 40 (MIA40)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MIA40; TIM40; KLLA0D02706g; Mitochondrial intermembrane space import and assembly protein 40; Mitochondrial import inner membrane translocase TIM40
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-406
Protein Length
Full Length of Mature Protein
Species
Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)
Target Names
MIA40
Target Protein Sequence
SAHPPSGGVSHMNKPALLLAGFSTLGAIYVADGCPTLIERKPAPAEKPAEETPAAGQSQS ISEPTKDADESPVSAQEEGAEPVTTPENEITYSEETHQALAATLSGDEPAAIEPVAESVN EQATEPAASGEATNEPVTGISEDTKAPSLSFDDSKTAKGVVLEDEADKKEIQQTSPDAVK TASKDGSEGESDVVLHEKSPAEAETITEAEEQAEIRSISGGTAEQSATAAAAAAGVQGEK KNEQQTAYNPETGEINWDCPCLGGMAYGPCGEEFKSAFSCFVYSEADPKGINCVEKFSTM QNCFRKYPDYYAEQIKDEEEASAEASKIEDKSTTPVSTATSTVEVQTENAVFEPVLEKYV EENPQLKDTPEAAAVTNTDDEKK
Uniprot No.

Target Background

Function

MIA40 (Mitochondrial intermembrane space import and assembly protein 40) is essential for the import and folding of small, cysteine-containing proteins (small Tims) within the mitochondrial intermembrane space (IMS). It functions in a redox cycle with ERV1, utilizing a disulfide relay system. Precursor proteins destined for the IMS are translocated in their reduced state into the mitochondria. Oxidized MIA40 forms a transient intermolecular disulfide bond with the reduced precursor protein, oxidizing the precursor. This allows the precursor protein, now containing an intramolecular disulfide bond, to fold correctly within the IMS.

Database Links
Subcellular Location
Mitochondrion inner membrane; Single-pass type II membrane protein; Intermembrane side.

Q&A

What is MIA40 and what is its primary function in mitochondria?

MIA40 (Mitochondrial Intermembrane Space Import and Assembly Protein 40) functions as a critical component of the mitochondrial disulfide relay system. It predominantly serves as a trans-site receptor that binds incoming proteins via hydrophobic interactions, thereby mediating protein translocation across the outer membrane . Unlike other known thiol-disulfide oxidoreductases, MIA40 does not belong to the thioredoxin family, yet it employs similar basic mechanisms for substrate binding via hydrophobic interactions . Its primary role involves facilitating the import and oxidative folding of cysteine-rich proteins in the mitochondrial intermembrane space (IMS).

What are the key structural domains of MIA40 and their functions?

MIA40 consists of two functionally distinct structural elements:

  • N-terminal redox-active domain: Contains a conserved cysteine-proline-cysteine (CPC) motif that mediates the oxidation of substrate proteins .

  • C-terminal substrate-binding domain: Features a hydrophobic pocket that recognizes and binds specific motifs in substrate proteins .

The hydrophobic substrate-binding pocket is positioned adjacent to the catalytic disulfide, allowing MIA40 to direct the oxidation process by targeting cysteines in hydrophobic regions for forming the initial mixed disulfide . This unique arrangement enables MIA40 to selectively interact with substrate proteins containing MISS (mitochondrial IMS sorting signal) or ITS (IMS targeting signal) motifs .

How does K. lactis MIA40 compare to MIA40 from other species?

Kluyveromyces lactis MIA40 shares significant structural and functional conservation with MIA40 from other yeast species like Saccharomyces cerevisiae. The K. lactis variant (Q6CSA1) is a 406-amino acid protein with the mature form spanning residues 24-406 . While specific differences exist between species, the core functional domains remain conserved across eukaryotes. The detailed sequence of K. lactis MIA40 includes critical cysteine residues essential for its redox function and a well-defined hydrophobic binding region for substrate recognition .

How does the MIA40-dependent protein import mechanism work?

MIA40 operates through a "holding trap" rather than a "folding trap" mechanism. While previous models suggested that disulfide bond formation drives the directional import of substrate proteins (folding trap), research now indicates that the hydrophobic binding function of MIA40 is both necessary and sufficient to promote protein import .

The import process follows these steps:

  • Substrate proteins enter the intermembrane space through the TOM complex

  • MIA40 recognizes specific hydrophobic motifs (MISS/ITS) in these proteins

  • The binding of substrates to MIA40's hydrophobic pocket provides the driving force for translocation

  • Subsequent oxidation by the CPC motif helps fold the proteins into their functional conformation

This model is supported by experiments showing that an oxidase-deficient MIA40 mutant (MIA40-SPS) can still efficiently drive protein import .

What is the "sliding-and-docking" model for MIA40-mediated protein oxidation?

The "sliding-and-docking" model explains how MIA40 guides the oxidation of its substrates:

  • MIA40 uses the amphipathic character of helices formed in the substrate protein to steer the oxidation mechanism

  • Hydrophobic residues that are one and/or two turns away from a cysteine residue in the helix form a MISS/ITS motif

  • This motif binds to the hydrophobic surface of MIA40, positioning a particular cysteine to form the critical first mixed disulfide

  • The binding directs the formation of specific disulfide bonds in a controlled sequence

This model explains how MIA40 can selectively target certain cysteines in hydrophobic environments, enabling the formation of correct disulfide bonds while minimizing the need for subsequent isomerization reactions .

How do mutations in different domains affect MIA40 function?

Research using yeast mutants has revealed distinct roles for MIA40's functional domains:

Domain AffectedMutation TypeFunctional ImpactViability
CPC motifMia40-SPS (C→S substitutions)Retains import function but loses oxidase activityInviable but partially rescuable with chemical oxidants
Substrate-binding domainMia40-FE (charge disruption)Prevents folding of binding domain, loses both import and oxidase functionsInviable
Substrate-binding domainMia40-STOP (truncation)Complete loss of binding capacity and functionInviable

These findings demonstrate that both domains are essential for full MIA40 function. While the substrate-binding domain is sufficient to drive protein translocation, the redox-active CPC motif is required for proper oxidative folding of imported proteins . Importantly, the two functional domains cannot cross-complement each other when expressed as separate mutants.

How does MIA40 influence cellular proteostasis beyond mitochondrial import?

MIA40 exerts broader effects on cellular proteostasis beyond its direct role in mitochondrial protein import:

  • Increased levels of MIA40 can counteract the occurrence of aggregate-inducing nucleation seeds formed by prion-like proteins

  • MIA40 overexpression suppresses growth arrest induced by aggregation-prone polyQ proteins

  • MIA40 is rate-limiting for the import of its substrates under physiological conditions, with overexpression leading to significantly higher cellular levels of many substrate proteins

These observations suggest that modulation of MIA40 levels serves as an efficient molecular mechanism to fine-tune cytosolic protein homeostasis . Importantly, overexpression of MIA40 increases the fraction of substrate proteins that successfully accumulate in the IMS rather than being degraded in the cytosol, indicating that endogenous MIA40 levels are a limiting factor in protein import efficiency .

What are the optimal storage and handling conditions for recombinant K. lactis MIA40?

For optimal results when working with recombinant K. lactis MIA40:

  • Store the lyophilized protein at -20°C/-80°C upon receipt

  • Aliquot the protein to avoid repeated freeze-thaw cycles, which reduce activity

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) for long-term storage

  • Store working aliquots at 4°C for up to one week

  • Use Tris/PBS-based buffer (pH 8.0) with 6% trehalose for stability

Following these guidelines will help maintain the protein's structural integrity and functional activity during experimental procedures.

How can researchers verify the redox state of MIA40's cysteine residues?

To assess the redox state of MIA40's cysteine residues, researchers can use the following approach:

  • Isolate mitochondria containing MIA40 (wild-type or mutant variants)

  • Precipitate proteins with trichloroacetic acid (TCA) to denature them and preserve their redox state

  • Incubate with maleimide-based alkylating agents such as mmPEG24 or mmPEG12, which cause mass shifts of approximately 1.2 and 0.7 kDa per alkylated thiol group, respectively

  • Analyze by SDS-PAGE and western blotting

  • Properly folded MIA40 shows two species: one with the CPC motif oxidized and another with the CPC motif reduced, both containing the two structural disulfides of the substrate-binding domain

  • Mutants with disrupted substrate-binding domains (e.g., MIA40-FE) show incomplete formation of structural disulfides

What experimental approaches can distinguish between MIA40's roles in protein import versus oxidative folding?

To differentiate between MIA40's import and oxidative functions, researchers can employ these strategies:

  • Domain-specific mutant analysis:

    • Use MIA40-SPS mutants (deficient in oxidase activity but retaining binding function) to isolate the import function

    • Compare protein import efficiency versus subsequent protein stability/folding

  • Chemical complementation:

    • Supplement oxidase-deficient MIA40 mutants with chemical oxidants like diamide

    • Assess whether protein import and accumulation can be restored

  • Redox state analysis of imported substrates:

    • Track the formation of disulfide bonds in newly imported proteins using alkylation assays

    • Compare the kinetics of import versus oxidation to determine their relationship

  • In vivo protein accumulation studies:

    • Monitor steady-state levels of MIA40 substrate proteins under conditions of MIA40 depletion, normal expression, and overexpression

    • Quantify the relationship between MIA40 levels and substrate accumulation

These approaches have revealed that MIA40 primarily functions as a trans-site receptor driving protein translocation, with its oxidase activity being important after the translocation step to fold proteins into functional conformations.

How can researchers assess the functional impact of C-terminal truncations of MIA40?

Studies have demonstrated that the C-terminal region of MIA40 is critical for its stability and function. To evaluate C-terminal truncation effects:

How can recombinant K. lactis MIA40 be used to study mitochondrial disease mechanisms?

Recombinant K. lactis MIA40 provides valuable tools for investigating mitochondrial diseases:

  • Reconstitution studies: Purified recombinant MIA40 can be used to reconstruct the mitochondrial disulfide relay system in vitro, allowing detailed mechanistic studies of disease-associated mutations.

  • Structural biology applications: Recombinant protein enables structural analysis through crystallography or NMR to examine how disease mutations impact protein conformation.

  • Protein-protein interaction assays: Immobilized MIA40 can be used in pull-down experiments to identify novel interaction partners or characterize altered interactions in disease states.

  • Proteostasis investigation: As MIA40 affects cellular proteostasis and can suppress protein aggregation, recombinant MIA40 can be used to study how mitochondrial import defects contribute to neurodegenerative diseases characterized by protein aggregation .

These applications provide insights into how disruptions in mitochondrial protein import pathways contribute to human disease pathology.

What advantages does K. lactis offer as an expression system for producing recombinant MIA40?

Kluyveromyces lactis presents several advantages as an expression system for MIA40:

  • Post-translational modifications: As a eukaryotic system, K. lactis can perform appropriate post-translational modifications, including disulfide bond formation, critical for MIA40 function.

  • Protein secretion capability: K. lactis has efficient protein secretion pathways, with the α-mating factor secretion domain allowing efficient production of secreted proteins .

  • Protein folding environment: Being a yeast, K. lactis provides a cellular environment more similar to the native conditions of MIA40 than bacterial expression systems.

  • Genetic tractability: K. lactis is genetically well-characterized with available expression vectors (such as pKLAC2) and transformation protocols .

  • Industrial relevance: K. lactis has been used extensively for various industrial applications, indicating its robustness as a production platform for recombinant proteins .

These characteristics make K. lactis a valuable system for producing functional MIA40 for research applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.