Recombinant Kluyveromyces lactis Mitochondrial outer membrane protein IML2 (IML2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will ship the format currently in stock unless you specify a preference during order placement. Please indicate any format requirements in your order notes.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs unless dry ice is requested. Dry ice shipments require prior arrangement and incur additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
IML2; KLLA0D02244g; Inclusion body clearance protein IML2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-725
Protein Length
full length protein
Species
Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)
Target Names
IML2
Target Protein Sequence
MFRVFNALTGAGSPKATELSGEERTKFILQQAHDFEIALQAMDYVLDDNAEVGLKLLADN QATSPGDATVGALAKGVIEFLEATLGFEPEVMKKASTTLAEAEQLSLKSRAKLQKLNIKT SSLYPPGTEYAVTYTESCLLHALLMLFSESMVEGAKALFKLRKAYHMLQDILKEINASEK RKRSSIYLQEINESTASFISSGTCFTSYDIPYKLTPEEEQDKELLDLANKVYSLRRKRLC GAHIGNSPAINRLRDDVGAASLKKGSDEETQEFQLLSDNANINQATMDEFIHSGVNLCFG ILQVVLSLIPPAIGAVLSVVGFHGSREEGLRLVWKSTKDRNIHGGIGLLGLLFYYDGPFQ FTDIDFDIPAARDDNLPVTEMDRPTLLHPGKILTSALLQARALFPNSALWLLQEARMLSK QGRLKEAVDLLDSIDHNTIEMKQVKALIVFEKATTLVYMHEFERGAETMLIMLSISEWSH ALYTYFAGCCYLEMFRKYEMGILNGENAAEKKAYYKERATNLVFESANMVGKKKFMSKIL PLDRFLLRKVDQFKKFQNIIKSSDPLDSIGVSPVHELIYFYNGYNRMTMKELNLSLKSLT EYRNPTIDLQNPDQELIKDLLTSLVLRRTGKIEEGCKILDTQVLPQLFTIQNDKVKYIKK TEDPWVYPTAFYERALFSWKLKGMNGLHEAHEWLIRAQNYQDDYELSTRIGMKIKAAKDR VEESI
Uniprot No.

Target Background

Function

Recombinant Kluyveromyces lactis Mitochondrial outer membrane protein IML2 (IML2) is an inclusion body (IB) resident protein that exhibits strong interaction with lipid droplet (LD) proteins. It is involved in LD-mediated IB clearing following protein folding stress, likely by facilitating access to the IBs of an LD-stored soluble sterol derivative that functions as a chaperone in inclusion clearing.

Database Links
Protein Families
IML2 family
Subcellular Location
Cytoplasm. Nucleus.

Q&A

What is Kluyveromyces lactis Mitochondrial Outer Membrane Protein IML2 and what are its known functions?

Kluyveromyces lactis Mitochondrial outer membrane protein IML2 (gene names: KLLA0_D02244g, IML2, KLLA0D02244g) is a protein localized to the mitochondrial outer membrane. While often described as an uncharacterized protein, it shares homology with Saccharomyces cerevisiae IML2, which functions in mitochondrial membrane organization . In S. cerevisiae, IML2 is also known as an inclusion body clearance protein, suggesting potential roles in protein quality control and mitochondrial proteostasis.

Based on comparative genomic analyses, IML2 likely participates in mitochondrial membrane architecture maintenance, potentially influencing the distinctive smooth outer membrane morphology that contrasts with the highly folded inner mitochondrial membrane . The protein may interact with membrane contact sites where mitochondria connect with other organelles for metabolite exchange and signaling pathway integration.

How does K. lactis compare to other yeast models for recombinant protein expression?

K. lactis presents several distinctive characteristics that make it a valuable complementary model to S. cerevisiae, particularly for mitochondrial studies:

CharacteristicK. lactisS. cerevisiaeRelevance to Research
MetabolismPredominantly respiratoryFermentativeK. lactis relies more heavily on mitochondrial function
Hypoxic responseDifferent gene regulation patternsWell-characterizedK. lactis shows unique hypoxic upregulation of genes like KlOYE2, KlGSH1, and KlOLE1
Oxidative stress responseDistinctive regulatory mechanismsYap1-mediated mechanismsGLR depletion affects metabolism differently in K. lactis
Genetic tractabilityGood expression systems availableExtensive genetic toolsBoth are amenable to genetic manipulation
Secretion capacityHigh secretion efficiencyVariable secretion efficiencyK. lactis can effectively secrete recombinant proteins

K. lactis demonstrates fundamental differences in respiratory metabolism compared to S. cerevisiae, making it particularly suitable for studies of mitochondrial proteins like IML2. The respiratory nature of K. lactis means that mitochondrial function is critical for its growth and survival, potentially amplifying phenotypes related to mitochondrial protein manipulation .

What expression systems are optimal for producing recombinant IML2 in laboratory settings?

Several expression systems can be employed for recombinant IML2 production, with selection depending on research objectives:

Expression SystemInducerAdvantagesConsiderationsOptimal Conditions
Native LAC4 promoterLactose/galactoseNative to K. lactis, tight regulationModerate expression levelsGrowth in galactose-containing media
T7 system in E. coliIPTGHigh yield, rapid expressionRisk of inclusion bodies, lacks yeast PTMs0.1 mM IPTG, low temperature (16-20°C)
K. lactis integration vectorVaries by vectorStable expression, proper foldingLonger development timeVector integration at LAC4 locus
Baculovirus system-Higher eukaryotic PTMs, membrane protein experienceMore complex, higher costInfection of insect cells

For experimental approaches requiring proper mitochondrial targeting, expression within K. lactis itself is recommended. The LAC4 promoter system allows homologous recombination at the native LAC4 locus as demonstrated in recombinant protein studies . For structural studies requiring higher protein yields, E. coli expression systems may be employed, though careful optimization is necessary to prevent inclusion body formation, especially for membrane proteins .

What protocols exist for verifying correct expression and localization of recombinant IML2?

Verification of IML2 expression and localization involves multiple complementary techniques:

Western Blot Analysis:

  • Prepare cell lysates from recombinant K. lactis strains

  • Separate proteins by SDS-PAGE (8-12% gel recommended for IML2's size)

  • Transfer to PVDF or nitrocellulose membrane

  • Block with 5% BSA or milk solution

  • Incubate with anti-IML2 primary antibody or anti-tag antibody if tagged version is used

  • Apply HRP-conjugated secondary antibody and develop

  • Expected size: approximately 30-32 kDa (variable based on glycosylation)

Subcellular Fractionation and Verification:

  • Isolate mitochondria using established yeast mitochondrial isolation protocols

  • Perform protease protection assays with and without membrane permeabilization

  • IML2 should show resistance to protease in intact mitochondria but degradation after outer membrane permeabilization

  • Use known mitochondrial outer membrane, inner membrane, and matrix proteins as controls

Fluorescence Microscopy:

  • Express IML2 fused to fluorescent proteins like GFP or YFP

  • Co-stain with mitochondrial dyes (MitoTracker)

  • Examine colocalization using confocal microscopy

  • Proper localization shows mitochondrial outer membrane pattern

How can researchers design experiments to investigate IML2's role in mitochondrial membrane dynamics?

Investigating IML2's role in mitochondrial dynamics requires multi-faceted experimental approaches:

Genetic Manipulation Strategies:

  • Create IML2 knockout strains using CRISPR-Cas9 or homologous recombination

  • Develop conditional expression systems using regulated promoters

  • Generate point mutations in predicted functional domains

  • Create chimeric proteins with domains from homologous proteins to map functional regions

Phenotypic Analyses:

  • Examine mitochondrial morphology using electron microscopy and fluorescence microscopy

  • Measure mitochondrial membrane potential using potential-sensitive dyes

  • Assess respiratory capacity through oxygen consumption measurements

  • Evaluate mitochondrial protein import efficiency

  • Analyze growth under respiratory vs. fermentative conditions

Interaction Studies:

  • Perform co-immunoprecipitation experiments with known mitochondrial membrane proteins

  • Use proximity labeling approaches (BioID or APEX2) to identify proteins in close proximity to IML2

  • Employ yeast two-hybrid screening with IML2 as bait

  • Utilize split-GFP complementation to verify specific protein-protein interactions in vivo

The comparative analysis of IML2 function across yeast species (K. lactis vs S. cerevisiae) can provide valuable insights, as the respiratory preference of K. lactis may reveal more prominent phenotypes related to mitochondrial function disruption .

What are the experimental approaches for studying protein-protein interactions of IML2 in mitochondrial membranes?

Studying protein-protein interactions of membrane proteins like IML2 presents unique challenges due to their hydrophobic nature and membrane environment. Several complementary approaches are recommended:

Crosslinking Mass Spectrometry (XL-MS):

  • Treat intact mitochondria with membrane-permeable crosslinkers

  • Isolate IML2 complexes using immunoprecipitation

  • Perform enzymatic digestion and analyze by LC-MS/MS

  • Identify crosslinked peptides to map interaction interfaces

Membrane-Based Yeast Two-Hybrid Systems:

  • Use split-ubiquitin membrane yeast two-hybrid system specifically designed for membrane proteins

  • Create bait constructs with IML2 fused to C-terminal ubiquitin fragment

  • Screen against prey libraries of mitochondrial proteins

  • Verify interactions using secondary assays

Quantitative Proteomics:

  • Compare mitochondrial proteome in wild-type vs. IML2 deletion strains

  • Identify proteins with altered abundance or modification status

  • Focus on proteins involved in membrane organization and fusion/fission machinery

  • Validate candidates using co-immunoprecipitation

Proximity-Based Labeling:

  • Express IML2 fused to biotin ligase (BioID) or peroxidase (APEX2)

  • Activate labeling in vivo to biotinylate proximal proteins

  • Purify biotinylated proteins and identify by mass spectrometry

  • Map the IML2 proximity interactome

These approaches should be applied with appropriate controls, including other mitochondrial membrane proteins with known interaction partners, to establish specificity of detected interactions .

How does mitochondrial membrane architecture in K. lactis relate to IML2 function?

Mitochondrial membrane architecture is intricately connected to function, and IML2's role must be understood in this context:

The mitochondrial outer membrane (OMM) in K. lactis, like in other yeasts, is relatively smooth compared to the highly folded inner membrane. The OMM contains pore-forming proteins allowing passage of small molecules while larger proteins require specific import machinery . IML2's localization to this membrane suggests potential roles in:

  • Membrane Contact Sites: IML2 may participate in tethering mitochondria to other organelles for metabolite exchange and signaling, similar to functions observed in related yeast species

  • Protein Import: Given its similarity to inclusion body clearance proteins, IML2 may facilitate protein translocation across the outer membrane or quality control of imported proteins

  • Membrane Fusion/Fission: IML2 might interact with mitochondrial fusion machinery components like Mfn1/2 homologs that mediate outer membrane fusion via GTPase activity

  • Lipid Transfer: Membrane remodeling requires lipid exchange between organelles, and IML2 could potentially play a role in this process

Experimental approaches to investigate these functions include:

  • Lipidomic analysis of mitochondrial membranes in wild-type versus IML2 mutant strains

  • Super-resolution microscopy to visualize membrane contacts and morphology

  • Electron microscopy to examine ultrastructural changes in membrane architecture

  • Mitochondrial fusion assays using fluorescently labeled mitochondria

The respiratory preference of K. lactis makes it particularly sensitive to perturbations in mitochondrial architecture, potentially making phenotypes related to IML2 dysfunction more pronounced than in fermentative yeasts .

What experimental design would be most effective for studying the impact of IML2 expression on cellular metabolism?

To comprehensively analyze how IML2 affects cellular metabolism, a multi-omics approach is recommended:

Experimental Design Table:

Analysis TypeTechniqueParameters MeasuredExpected Outcomes
TranscriptomicsRNA-SeqGene expression changesAltered respiratory gene expression profiles
ProteomicsLC-MS/MSProtein abundance changesChanges in mitochondrial protein complex composition
MetabolomicsGC-MS, LC-MSMetabolite concentrationsAltered TCA cycle intermediates, respiratory substrates
RespirometryOxygen electrodeOxygen consumption ratesChanges in respiratory capacity
Mitochondrial functionMembrane potential assaysΔψmImpact on electrochemical gradient maintenance
Growth phenotypingGrowth curvesGrowth rates on different carbon sourcesDifferential growth on fermentable vs. non-fermentable substrates

Experimental Groups:

  • Wild-type K. lactis (control)

  • IML2 deletion strain (Δiml2)

  • IML2 overexpression strain

  • Conditional expression strains (for time-course studies)

Growth Media Conditions:

  • Glucose (fermentable carbon source)

  • Glycerol (non-fermentable, requires respiration)

  • Varying oxygen concentrations to assess hypoxic response differences

The collected data should be integrated using systems biology approaches to map the metabolic networks affected by IML2 expression. Given K. lactis's respiratory preference, particular attention should be paid to changes in pathways like the TCA cycle, electron transport chain, and the pentose phosphate pathway, which shows interesting regulatory differences between K. lactis and S. cerevisiae .

How can researchers optimize purification protocols for recombinant IML2 protein while maintaining native structure?

Purifying membrane proteins like IML2 while preserving native structure requires specialized protocols:

Optimized Purification Protocol:

  • Expression System Selection:

    • K. lactis expression preserves native post-translational modifications

    • E. coli expression yields higher protein amounts but may require refolding

    • Consider fusion tags: His-tag at N-terminus (to avoid interference with membrane insertion)

  • Membrane Extraction:

    • Isolate mitochondria using differential centrifugation

    • Solubilize membranes using mild detergents:

      • n-Dodecyl β-D-maltoside (DDM): 1-2% for initial extraction

      • Digitonin: 1% for gentler extraction preserving protein-protein interactions

      • CHAPS: 0.5-1% as alternative for structure preservation

  • Affinity Purification:

    • Immobilized metal affinity chromatography (IMAC) for His-tagged IML2

    • Use detergent concentrations above critical micelle concentration (CMC) in all buffers

    • Include glycerol (10-15%) to stabilize protein structure

  • Quality Assessment:

    • Size exclusion chromatography to verify monodispersity

    • Circular dichroism to assess secondary structure

    • Thermal shift assays to optimize buffer conditions

    • Activity assays (if known) to confirm functional state

  • Reconstitution Options:

    • Nanodiscs for structural studies (MSP1D1 scaffold recommended)

    • Liposomes with mitochondrial lipid composition for functional studies

    • Amphipols as alternative to detergents for long-term stability

Critical Considerations:

  • Temperature: Maintain samples at 4°C throughout purification

  • Protease inhibitors: Include comprehensive cocktail to prevent degradation

  • Reducing agents: Include to prevent oxidation of cysteine residues

  • Glycerol or sucrose: Add 5-10% to prevent aggregation

  • Buffer pH: Optimize between 7.0-8.0 for stability

The purification protocol should be validated by assessing protein purity (>85% by SDS-PAGE) and structural integrity through functional assays or structural studies .

What are the comparative characteristics of IML2 homologs across different yeast species and their evolutionary implications?

Comparative analysis of IML2 across yeast species provides valuable evolutionary insights:

SpeciesGene IdentifierKey FeaturesUnique CharacteristicsMetabolic Context
Kluyveromyces lactisKLLA0_D02244gMitochondrial outer membrane proteinUncharacterized, present in respiratory yeastPredominantly respiratory metabolism
Saccharomyces cerevisiaeIML2Inclusion body clearance proteinBetter characterized, functions in proteostasisPredominantly fermentative metabolism
Yarrowia lipolyticaYALI0F29491gMitochondrial outer membrane proteinLonger sequence, additional domainsStrong respiratory preference, oleaginous yeast
Candida glabrataCAGL0M03179gMitochondrial outer membrane proteinPartially characterizedIntermediate respiratory capacity
Debaryomyces hanseniiDEHA2B01254gMitochondrial outer membrane proteinPartial protein, salt-tolerant speciesRespiratory metabolism

The evolutionary conservation of IML2 across species with different metabolic preferences suggests fundamental roles in mitochondrial function. Species-specific adaptations in IML2 structure may reflect adaptations to different metabolic strategies and environmental niches.

Research approaches to leverage these comparative aspects include:

  • Multiple sequence alignment to identify conserved domains and species-specific variations

  • Heterologous expression studies (expressing IML2 from one species in another)

  • Domain-swapping experiments to map functional regions

  • Evolutionary rate analysis to identify regions under selective pressure

The differences in IML2 between predominantly respiratory yeasts like K. lactis and fermentative yeasts like S. cerevisiae may provide insights into how mitochondrial membrane proteins have adapted to support different metabolic strategies during yeast evolution .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.