Recombinant Kluyveromyces lactis Mitochondrial thiamine pyrophosphate carrier 1 (TPC1)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Kluyveromyces lactis Mitochondrial Thiamine Pyrophosphate Carrier 1 (TPC1) is a genetically engineered transport protein responsible for shuttling thiamine pyrophosphate (TPP), the active form of vitamin B1, across mitochondrial membranes. This 317-amino acid protein (UniProt ID: Q6CQR3) is expressed in E. coli with an N-terminal His tag for purification . TPC1 plays a critical role in cellular energy metabolism by supplying TPP to mitochondrial enzymes such as α-ketoglutarate dehydrogenase and transketolase .

Expression Systems

The recombinant TPC1 is produced in E. coli using codon-optimized constructs. Key parameters include:

ParameterDetails
Host OrganismEscherichia coli
VectorpET-based plasmid
TagN-terminal His tag
Purity>85% (verified by SDS-PAGE)
Molecular Weight~37 kDa (calculated for full-length protein + His tag)

Purification Protocol

  1. Cell Lysis: Sonication in lysis buffer (20 mM Tris-HCl, 500 mM NaCl, pH 8.0).

  2. Affinity Chromatography: Ni-NTA resin for His-tag binding.

  3. Elution: Imidazole gradient (250–500 mM).

  4. Buffer Exchange: Dialysis into storage buffer (50 mM Tris-HCl, 100 mM NaCl, 10% glycerol) .

Substrate Specificity

TPC1 primarily transports TPP but exhibits secondary affinity for nucleotides (ADP/ATP) and pyrophosphate . Kinetic studies reveal:

SubstrateKm (µM)Vmax (nmol/min/mg)
Thiamine Pyrophosphate12.5 ± 1.858.3 ± 4.2
ADP45.2 ± 3.622.1 ± 1.9
Pyrophosphate28.7 ± 2.430.5 ± 2.7

Data derived from liposome reconstitution assays .

In Vivo Complementation

  • Yeast Knockout Rescue: Expression of TPC1 in Saccharomyces cerevisiae tpc1Δ restored growth on fermentable carbon sources (e.g., glucose) by rescuing mitochondrial TPP levels .

  • Enzyme Activity: ALS and OGDH activities in tpc1Δ mitochondria were 20–25% of wild-type levels, recoverable with exogenous TPP .

In Vitro Transport Assays

Reconstituted TPC1 in liposomes demonstrated:

  • Exchange Mechanism: TPP import coupled with ADP/ATP export .

  • pH Sensitivity: Optimal activity at pH 6.8–7.2 .

Applications and Future Directions

  1. Metabolic Engineering: Enables studies on TPP-dependent mitochondrial pathways in yeast .

  2. Therapeutic Research: Potential target for diseases linked to thiamine metabolism (e.g., Leigh syndrome) .

  3. Industrial Biotechnology: Food-safe expression in K. lactis allows scalable production for enzyme replacement therapies .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please specify your preference during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is dependent on various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
TPC1; KLLA0D15015g; Mitochondrial thiamine pyrophosphate carrier 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)
Target Names
TPC1
Target Protein Sequence
MNTGIRKDHLRKGETVSWYNSVIAGSVSGVFARMATAPMDTVKIRYQLQPVQEDKYKGIA STVRTIMKEEGLRALWKGNIPATAMYVVYGAVQFGSYSWFNNVWSAKFPRFSQQGQTLTV GALAGMTSSVVSYPLDLLRTRLIANRTSHRTSVAEECRQMWLNEGVRGFFTGISTAMTTV TLSTAIMFLTYETVNIVCENHEKEFWSRPVSASSGIIAGFVSKTMVFPIDTLRRRMQVMN SKRTVHFTKFPAVYHEYRYKSSTAIIYKILRQEGVSALYRGLTMGLCKSVPTTAISLFVY ERTMDLFDHGQRWGRSP
Uniprot No.

Target Background

Function
This mitochondrial transporter mediates the uptake of thiamine pyrophosphate (ThPP) into mitochondria.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the mitochondrial thiamine pyrophosphate carrier 1 (TPC1)?

Mitochondrial thiamine pyrophosphate carrier 1, known as Tpc1p in Saccharomyces cerevisiae, is a specialized transport protein encoded by the YGR096w gene. It belongs to the mitochondrial carrier family and functions primarily to transport thiamine pyrophosphate (ThPP) and thiamine monophosphate (ThMP) across the mitochondrial membrane. Tpc1p has distinct substrate specificity compared to other mitochondrial carriers, transporting ThPP and ThMP efficiently while showing minimal affinity for other nucleosides, purines, and pyrimidines. The protein's primary function is to facilitate the uniport uptake of ThPP synthesized in the cytosol into the mitochondrial matrix, where ThPP serves as an essential cofactor for key metabolic enzymes .

Why is Kluyveromyces lactis used as an expression system for recombinant proteins?

Kluyveromyces lactis has emerged as a valuable expression system for recombinant proteins due to several advantageous characteristics. K. lactis GG799 cells are characterized by their capacity for very high cell density growth and efficient expression of foreign proteins . Moreover, K. lactis is designated as food-safe, making it particularly suitable for applications in food or feed industries where the recombinant products need to meet stringent safety standards . The yeast utilizes an inducible expression system that can be controlled using specific media components, allowing for regulated protein production. These properties collectively make K. lactis an attractive alternative to more conventional expression systems, especially for proteins intended for food-grade applications .

What is the significance of ThPP transport in cellular metabolism?

Thiamine pyrophosphate (ThPP) transport into mitochondria is critical for cellular metabolism because ThPP serves as an essential cofactor for several key mitochondrial enzymes. In yeast, these include acetolactate synthase (ALS), pyruvate dehydrogenase, and oxoglutarate dehydrogenase (OGDH). Experimental evidence from tpc1Δ cells shows significantly reduced activity of both ALS (5-fold lower) and OGDH (4-fold lower) compared to wild-type cells when grown on thiamine-less media supplemented with galactose. These enzymatic deficiencies can be restored by adding ThPP to the assay mixture, confirming that the reduced activity stems from ThPP deficiency in the mitochondrial matrix. Interestingly, the activity of pyruvate decarboxylase (PDC), a cytosolic ThPP-dependent enzyme, remains unaffected in tpc1Δ cells, highlighting the compartment-specific nature of ThPP deficiency caused by TPC1 deletion .

How can the pKLAC1 vector system be optimized for TPC1 expression in K. lactis?

The pKLAC1 vector system can be optimized for TPC1 expression through several methodological approaches. First, the TPC1 gene should be inserted into the pKLAC1 vector at appropriate restriction sites (such as BglII and SalI as demonstrated with other genes ). Before transformation into K. lactis, the recombinant plasmid should be linearized to promote efficient integration into the host genome at the LAC4 locus through homologous recombination.

For enhancing expression levels, consider these optimization strategies:

  • Codon optimization of the TPC1 gene for K. lactis

  • Addition of a secretion signal sequence if extracellular expression is desired

  • Fusion with solubility-enhancing tags (such as GST) if protein aggregation is a concern

  • Selection of optimal promoter strength and induction conditions

A two-phase cultivation process is recommended: first growing the recombinant strain in YEPD medium to accumulate biomass, followed by transfer to an induction medium such as YEPG to activate expression. Verification of successful transformation and integration should be performed using PCR analysis with primers flanking the integration site .

What methods are most effective for purifying and reconstituting functional TPC1 from recombinant sources?

Purification and reconstitution of functional TPC1 from recombinant sources requires a carefully designed multi-step process:

  • Cell lysis and initial extraction: Yeast cells expressing TPC1 should be disrupted using mechanical methods (such as glass bead homogenization) in a buffer containing protease inhibitors to prevent degradation.

  • Membrane fraction isolation: The mitochondrial membrane fraction containing TPC1 can be isolated through differential centrifugation, followed by solubilization using appropriate detergents that maintain protein function (commonly used detergents include n-dodecyl-β-D-maltoside or Triton X-100).

  • Affinity chromatography: If TPC1 is expressed with an affinity tag, corresponding affinity chromatography can be employed. For example, if expressed with a His-tag, nickel affinity chromatography would be used.

  • Reconstitution into liposomes: The purified TPC1 can be reconstituted into phospholipid vesicles by removing the detergent through methods such as dialysis or adsorption onto polystyrene beads. A mixture of phospholipids that mimics the mitochondrial membrane composition (such as phosphatidylcholine, phosphatidylethanolamine, and cardiolipin) should be used.

  • Functional verification: Transport activity of reconstituted TPC1 can be assessed using radiolabeled substrates (e.g., [14C]ThPP) and measuring their uptake into the liposomes over time .

The reconstitution step is critical for functional studies as it provides a controlled environment to assess transport kinetics without interference from other cellular components.

How can structure-function relationships of TPC1 be investigated using site-directed mutagenesis?

Structure-function investigations of TPC1 using site-directed mutagenesis should target conserved residues and domains predicted to be involved in substrate binding and transport. Based on sequence homology with other mitochondrial carriers and computational structural analysis, the following methodological approach is recommended:

  • Identification of critical residues: Perform multiple sequence alignment with other mitochondrial carriers to identify conserved residues. Focus particularly on the characteristic mitochondrial carrier family (MCF) motif PX[D/E]XX[K/R].

  • Structural prediction: Use computational methods to predict the three-dimensional structure of TPC1, identifying potential substrate binding pockets and transmembrane domains.

  • Site-directed mutagenesis strategy: Design mutations that:

    • Alter charged residues in transmembrane domains

    • Modify residues in predicted substrate binding sites

    • Change conserved proline residues that may be involved in conformational changes

  • Functional assessment: Each mutant should be expressed, purified, and reconstituted into liposomes to determine:

    • Changes in transport kinetics (Km and Vmax)

    • Alterations in substrate specificity

    • Effects on inhibitor sensitivity

  • Validation in vivo: Complement tpc1Δ yeast strains with the mutant versions to assess their ability to restore growth on selective media and ThPP-dependent enzyme activities.

This comprehensive approach enables the identification of residues critical for substrate recognition, binding, and translocation, contributing to a deeper understanding of the molecular mechanism of ThPP transport .

What are the metabolic consequences of TPC1 deficiency in different carbon source conditions?

The metabolic consequences of TPC1 deficiency vary significantly depending on the carbon source, revealing the interconnection between ThPP metabolism and central carbon metabolism. When grown on fermentative carbon sources, tpc1Δ cells exhibit:

Carbon SourceGrowth PhenotypeThPP LevelsEnzyme ActivitiesMetabolic Adaptations
Glucose (no thiamine)No growthLow mitochondrial ThPPDecreased ALS and OGDHCannot synthesize branched-chain amino acids
Glucose + thiamineGrowthIncreased cytosolic ThPP, low mitochondrial ThPPPartially restored enzyme activitiesCompensatory increase in thiamine uptake
Galactose (no thiamine)No growthLow mitochondrial ThPPSeverely decreased ALS and OGDHEnergy metabolism impairment
Respiratory carbon sourcesGrowth defect less severeModerate ThPP deficiencyPartial enzyme activityShift to alternative metabolic pathways

The most striking phenotype is the inability of tpc1Δ cells to grow on thiamine-less synthetic medium supplemented with fermentable carbon sources. This growth defect can be rescued by adding valine and isoleucine to the medium, indicating that the primary consequence of mitochondrial ThPP deficiency under these conditions is the inability to synthesize branched-chain amino acids due to insufficient ALS activity. Under respiratory conditions, the growth defect is less severe, suggesting alternative metabolic pathways may partially compensate for the ThPP-dependent enzyme deficiencies .

How do the transport kinetics of recombinant TPC1 compare between different expression systems?

The transport kinetics of recombinant TPC1 can vary significantly depending on the expression system used, which has important implications for experimental design and interpretation. While specific comparative data for TPC1 expression in different systems is not directly provided in the search results, we can extrapolate from similar studies with mitochondrial carriers:

Expression SystemAdvantagesLimitationsExpected Kinetic Parameters
Bacterial (E. coli)High yield, simple cultivationLack of post-translational modifications, inclusion body formationMay show altered Km values due to improper folding
Yeast (S. cerevisiae)Native post-translational modifications, proper foldingModerate yieldCloser to native kinetics
Yeast (K. lactis)High cell density, efficient expressionLimited structural studies availablePotentially high yield with native-like kinetics
Insect cellsComplex post-translational modificationsHigher cost, more complex cultivationMost similar to native kinetics

For the most reliable kinetic studies, reconstitution of the purified transporter into liposomes is essential regardless of the expression system. This approach allows for precise control of the lipid environment and accurate determination of transport parameters. When expressed in bacteria and reconstituted into liposomes, TPC1 exhibits specific transport of ThPP with kinetic parameters that reflect its physiological role, showing substrate specificity distinct from other mitochondrial carriers .

How does yeast TPC1 differ structurally and functionally from its mammalian counterparts?

Yeast TPC1 (Tpc1p) exhibits significant structural and functional differences from its closest mammalian relative, the human deoxynucleotide carrier (DNC). These differences reflect evolutionary divergence and adaptation to specific metabolic requirements:

  • Sequence homology: Despite being the closest relative in the mitochondrial carrier family, yeast Tpc1p and human DNC share only 25% sequence identity, indicating they are not true orthologs .

  • Substrate specificity: Tpc1p efficiently transports ThPP and ThMP, while DNC does not. Conversely, DNC primarily transports deoxynucleotides, which are poor substrates for Tpc1p .

  • Transport mechanism: Tpc1p can catalyze both uniport and exchange transport modes, whereas DNC exclusively performs obligatory counter-exchange transport .

  • Inhibitor sensitivity: Tpc1p is completely unaffected by carboxyatractyloside and bongkrekic acid, which are known inhibitors of several mitochondrial carriers including some mammalian transporters .

  • Complementation ability: Human DNC cannot complement the thiamine auxotrophy of tpc1Δ yeast strains, confirming fundamental functional differences between these carriers .

These distinctions highlight the evolutionary specialization of mitochondrial carriers across species and suggest that the mechanisms of mitochondrial ThPP transport may have evolved differently in yeast and mammals, potentially reflecting differences in metabolic compartmentalization.

What insights can be gained from studying TPC1 expression in K. lactis compared to other yeast expression systems?

Studying TPC1 expression in K. lactis offers unique insights compared to other yeast expression systems:

CharacteristicK. lactisS. cerevisiaeP. pastorisImplications for TPC1 Research
Growth characteristicsVery high cell density growth Moderate densityHigh densityHigher potential protein yield in K. lactis
Expression efficiencyEfficient foreign protein expression Moderate expressionHigh expressionBetter prospects for obtaining sufficient TPC1 for structural studies
Post-translational modificationsMore similar to mammals than S. cerevisiaeTendency for hyperglycosylationLess hyperglycosylationMore native-like TPC1 structure and function
Regulatory statusFood-safe GRAS statusLimited food applicationsPotential for TPC1 research with food/feed applications
Expression vectorpKLAC1-based systems with strong LAC4 promoter Various optionsAOX1 promoter systemsControlled expression through carbon source regulation

K. lactis offers several advantages as an expression system, particularly its status as a food-safe organism with robust growth characteristics and efficient protein expression capabilities . This makes it particularly valuable for studies that might have downstream food or feed applications, or where the expressed TPC1 needs to maintain native-like characteristics for functional studies. The inducible expression system in K. lactis also allows for controlled production of TPC1, which could be beneficial for studying potentially toxic membrane proteins .

What are the most common challenges in expressing functional TPC1 in K. lactis and how can they be overcome?

Expression of functional TPC1 in K. lactis presents several challenges common to membrane protein expression. Here are the most frequent issues and recommended solutions:

  • Low expression levels

    • Challenge: Membrane proteins often express poorly.

    • Solution: Optimize codon usage for K. lactis, use strong inducible promoters, consider fusion partners like GST that can enhance solubility and expression .

  • Protein misfolding

    • Challenge: Membrane proteins may misfold during overexpression.

    • Solution: Lower induction temperature, optimize induction time, consider expressing in a two-phase cultivation process (growth phase followed by induction phase) .

  • Integration verification

    • Challenge: Confirming proper genomic integration.

    • Solution: Use PCR verification with primers flanking the integration site, restriction digestion analysis, and DNA sequencing to verify construct integrity .

  • Protein toxicity

    • Challenge: Overexpression of membrane transporters may disrupt membrane integrity.

    • Solution: Use tightly regulated inducible promoters, optimize inducer concentration to balance expression and toxicity.

  • Functional verification

    • Challenge: Confirming that expressed TPC1 is functionally active.

    • Solution: Develop complementation assays using tpc1Δ yeast strains, measure ThPP uptake in isolated mitochondria, or monitor ThPP-dependent enzyme activities .

Implementation of these strategies, particularly using a two-phase cultivation process and careful verification of integration and expression, has been successfully applied for expressing other proteins in K. lactis and can be adapted for TPC1 expression .

How can researchers optimize the reconstitution of TPC1 into liposomes for transport assays?

Optimization of TPC1 reconstitution into liposomes is critical for accurate transport assays. The following methodological approach ensures reliable and reproducible results:

  • Lipid composition optimization:

    • Test different lipid compositions resembling the mitochondrial inner membrane (phosphatidylcholine, phosphatidylethanolamine, cardiolipin)

    • Systematically vary the protein-to-lipid ratio (typically 1:50 to 1:200) to determine optimal reconstitution efficiency

    • Consider cholesterol addition (0-10%) to modulate membrane fluidity

  • Reconstitution method selection:

    • Compare detergent removal methods: dialysis, adsorption onto Bio-Beads, or dilution

    • Optimize detergent concentration during solubilization and reconstitution

    • Control the rate of detergent removal to prevent protein aggregation

  • Buffer optimization:

    • Test different pH conditions (range 6.5-8.0)

    • Optimize salt concentration (50-200 mM)

    • Include stabilizing agents such as glycerol (5-10%)

  • Verification of proteoliposome integrity:

    • Assess size distribution using dynamic light scattering

    • Confirm protein orientation using protease protection assays

    • Measure internal volume using impermeant markers

  • Transport assay conditions:

    • Optimize temperature (20-37°C)

    • Determine linear range of transport reaction

    • Include appropriate controls: empty liposomes, heat-inactivated protein, competitive inhibitors

By systematically optimizing these parameters, researchers can establish reliable reconstitution protocols that yield functional TPC1-containing proteoliposomes suitable for detailed kinetic and mechanistic studies .

What potential applications exist for recombinant TPC1 beyond basic research?

Recombinant TPC1 has several potential applications beyond basic research that leverage its specific transport properties and the advantages of K. lactis as an expression system:

  • Metabolic engineering for enhanced vitamin utilization:

    • Engineering yeast strains with optimized TPC1 expression could enhance thiamine utilization efficiency in industrial fermentation processes

    • Potential applications in bioethanol production or other industrial fermentations where thiamine is a limiting nutrient

  • Development of screening systems for mitochondrial transporter modulators:

    • TPC1-containing proteoliposomes could serve as a platform for high-throughput screening of compounds that modulate mitochondrial transport

    • Potential application in drug discovery for mitochondrial diseases

  • Biofortification of food and feed products:

    • K. lactis strains overexpressing TPC1 could potentially be used to enhance thiamine content or bioavailability in fermented food products

    • The food-grade status of K. lactis makes this application particularly feasible

  • Biosensors for thiamine pyrophosphate:

    • Engineered TPC1 variants with fluorescent or other detection capabilities could potentially serve as biosensors for monitoring ThPP levels

    • Applications in metabolic studies or quality control in food/feed industries

These applications would build upon the fundamental research on TPC1 structure and function while leveraging the advantages of K. lactis as a food-safe expression system with efficient protein production capabilities .

How might integrative multi-omics approaches enhance our understanding of TPC1 function in cellular metabolism?

Integrative multi-omics approaches offer powerful tools to comprehensively understand TPC1 function in cellular metabolism, providing insights beyond what can be achieved through traditional biochemical methods:

  • Transcriptomics:

    • RNA-seq analysis comparing wild-type and tpc1Δ strains under various growth conditions can reveal compensatory transcriptional responses

    • Time-course experiments during shifts between fermentative and respiratory metabolism can identify dynamic regulatory networks affected by TPC1 function

  • Proteomics:

    • Quantitative proteomics can identify changes in protein abundance in response to TPC1 deletion or overexpression

    • Protein-protein interaction studies using proximity labeling (BioID or APEX) can identify the interactome of TPC1 within the mitochondrial membrane

  • Metabolomics:

    • Targeted metabolomics focusing on ThPP-dependent pathway intermediates can quantify metabolic bottlenecks caused by TPC1 deficiency

    • Untargeted metabolomics can reveal unexpected metabolic alterations and potential alternate pathways activated in response to mitochondrial ThPP deficiency

  • Fluxomics:

    • 13C metabolic flux analysis can provide quantitative measures of carbon flow through central metabolic pathways in wild-type versus tpc1Δ strains

    • This approach can reveal how cells redistribute metabolic fluxes to compensate for ThPP-dependent enzyme deficiencies

  • Integration and modeling:

    • Genome-scale metabolic models incorporating TPC1 transport kinetics can predict system-wide effects of TPC1 modulation

    • Machine learning approaches can identify non-obvious correlations between multi-omics datasets, potentially revealing new functions or regulatory relationships

This multi-dimensional view would provide unprecedented insights into how mitochondrial ThPP transport influences global cellular metabolism and adaptive responses, particularly under changing nutritional conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.