Recombinant Kluyveromyces lactis Palmitoyltransferase ERF2 (ERF2)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant ERF2

Palmitoyltransferase ERF2 (UniProt ID: Q6CQB5) is a DHHC cysteine-rich domain-containing enzyme responsible for catalyzing protein S-palmitoylation, a lipid modification critical for membrane anchoring and protein trafficking . The recombinant form is heterologously expressed in E. coli or Kluyveromyces lactis systems to enable scalable production .

Key AttributesDetails
Gene NameERF2 (KLLA0D18370g)
Protein NamesPalmitoyltransferase ERF2; Ras protein acyltransferase
EC Number2.3.1.-
OrganismKluyveromyces lactis (strain ATCC 8585/CBS 2359)
Recombinant Expression HostE. coli (e.g., Creative BioMart , Cusabio )

Research Findings and Comparative Advantages

  • Thermostability: K. lactis-expressed enzymes (e.g., sulfotransferases) exhibit higher specific activity and thermostability than E. coli-derived counterparts .

  • Cost-Effective Synthesis: Gram-scale PAPS (3'-phosphoadenosine-5'-phosphosulfate) production using K. lactis systems reduces costs by 99.98% compared to commercial sources .

  • Toxicity Mitigation: Modified LAC4 promoters in K. lactis minimize background expression in E. coli, preventing toxicity during plasmid assembly .

Challenges and Future Directions

While ERF2’s role in Ras acylation is established, detailed mechanistic studies on its substrate range remain limited. Advances in K. lactis expression systems—such as glycosylation-enabled secretion and carbon source-responsive promoters —could enhance ERF2’s applicability in synthetic biology and therapeutic protein engineering.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ERF2; KLLA0D18370g; Palmitoyltransferase ERF2; DHHC cysteine-rich domain-containing protein ERF2; Ras protein acyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-355
Protein Length
full length protein
Species
Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)
Target Names
ERF2
Target Protein Sequence
MIERFMRNDKDRPSARDGQQNGTNDDSYFVKFLHWIITLDTYDGSSRNYGRMTETTNYTF FFGGRVRTVTKTSVYSIVVFAMFIVPLILFSIFECNYLWHHKGTNWKPAIVILYYFYLLT ICSFLRAACSDPGIVPRNVHIPDLNASYKIPQEYYNYAILPTKNPNASVSMKYCQTCRIW RPPRSAHCSVCDVCVLSHDHHCKWLNNCIGKRNYRFFLEFLMASTISCILLILLSSFRLS YSPQVRYTPVSLLIICYCGLGIWYPLILFIYHIFLAGTQQTTHEYLRSIGSKHPIFHKIT RNRDSPYDRNSMFFNLIHLWFQERGWNLVDPRRKQHYPADIRFRKLPEAHSFETV
Uniprot No.

Target Background

Function
The ERF2-ERF4 complex is a palmitoyltransferase specific for Ras proteins.
Database Links
Protein Families
DHHC palmitoyltransferase family, ERF2/ZDHHC9 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Palmitoyltransferase ERF2 and what is its function in yeast cells?

Palmitoyltransferase ERF2 (Effect on Ras Function 2) is a DHHC protein acyltransferase that catalyzes the palmitoylation of Ras proteins. ERF2 functions as part of a complex with ERF4 (previously known as SHR5) to enable proper subcellular localization and function of Ras proteins . The protein contains a characteristic cysteine-rich domain with a DHHC motif (DHHC-CRD) that is essential for its catalytic activity .

Palmitoylation occurs through a two-step mechanism:

  • The cysteine in the ERF2 DHHC motif undergoes autopalmitoylation to create a thioester-linked palmitoyl intermediate

  • The palmitate is then transferred from the enzyme cysteine to the cysteine of the Ras substrate

This post-translational modification is critical for proper membrane association and function of Ras proteins, which are involved in signal transduction pathways regulating cell growth and division.

Why is Kluyveromyces lactis preferred as an expression system for recombinant proteins?

K. lactis has emerged as one of the most important yeast species for both research and industrial biotechnology due to several advantageous characteristics:

  • It is a Crabtree-negative species suitable for the production of metabolites and heterologous proteins

  • It has a GRAS (Generally Regarded As Safe) status, making it appropriate for food and feed industry applications

  • It demonstrates high levels of protein secretion, making it an attractive alternative for industrial protein production

  • It can grow to high cell density, facilitating efficient expression of foreign proteins

  • It provides a complementary model to S. cerevisiae for studying cellular processes in reference to multicellular eukaryotes

Since 1991, approximately 100 recombinant proteins have been successfully expressed in K. lactis, with 20% of these produced in just the last few years prior to 2016, demonstrating its growing importance in biotechnology .

How does the ERF2-ERF4 complex function in protein palmitoylation?

The ERF2-ERF4 complex is essential for Ras palmitoylation in yeast. Research has revealed several key aspects of this functional relationship:

  • ERF4 is required for the stable formation of the palmitoyl-ERF2 intermediate, which is the first critical step of palmitoyl transfer to protein substrates

  • In the absence of ERF4, the rate of hydrolysis of the active site palmitoyl thioester intermediate increases, resulting in reduced palmitoyl transfer to Ras substrates

  • ERF4 affects the stability of ERF2 through an ubiquitin-mediated pathway; without ERF4, ERF2 undergoes degradation via the ER quality control pathway (ERAD)

  • Even when ERF2 is stabilized in the absence of ERF4, palmitoyl transferase activity is not restored, indicating that ERF4 has multiple distinct functions beyond stabilization

This relationship represents the first documented example of regulation of a DHHC PAT (Protein Acyl Transferase) enzyme by an associated protein .

What mechanisms regulate ERF2 stability and function?

Regulation of ERF2 stability and function occurs through multiple mechanisms:

  • ERF4-dependent stabilization: ERF4 protects ERF2 from degradation via the ubiquitin-mediated ER quality control pathway (ERAD). In the absence of ERF4, ERF2 undergoes ubiquitination and subsequent degradation .

  • Autopalmitoylation regulation: ERF4 is required for the stable formation of the palmitoyl-ERF2 intermediate. Without ERF4, the rate of hydrolysis of the active site palmitoyl thioester intermediate increases significantly .

  • Functional independence from stability: Experiments have shown that even when ERF2 is artificially stabilized in the absence of ERF4, its palmitoyl transferase activity is not restored. This indicates that ERF4 has distinct roles in both stabilizing ERF2 and enabling its enzymatic function .

  • Structural organization: The ERF2 protein harbors a cysteine-rich domain containing a DHHC motif (DHHC-CRD) that is critical for its catalytic function. This domain must remain properly configured for effective palmitoylation activity .

This complex regulation makes ERF2 a prime example of how DHHC protein acyltransferases can be controlled through protein-protein interactions.

How do mutations in the DHHC domain affect ERF2's palmitoyltransferase activity?

The DHHC (Asp-His-His-Cys) domain is crucial for ERF2's catalytic function. While specific data on ERF2 mutations from the search results is limited, research on DHHC proteins reveals:

Since ERF2's function depends on proper complex formation with ERF4, mutations might also affect this protein-protein interaction, indirectly reducing palmitoyltransferase activity even if the catalytic mechanism remains intact .

What methodologies are most effective for studying ERF2-substrate interactions?

Several methodologies have proven effective for investigating ERF2-substrate interactions:

Biochemical Approaches:

  • In vitro palmitoylation assays: Using purified components to measure the transfer of radiolabeled or clickable palmitate analogs from palmitoyl-CoA to substrate proteins .

  • Co-immunoprecipitation: Identifying physical interactions between ERF2-ERF4 complex and potential substrate proteins.

  • Yeast two-hybrid screening: Detecting direct protein-protein interactions between ERF2 and candidate substrates.

Cellular and Genetic Approaches:

  • Palmitoylation state analysis: Using acyl-biotin exchange (ABE) or click chemistry approaches to compare palmitoylation levels of proteins in wild-type versus ERF2-deficient strains.

  • Localization studies: Tracking changes in subcellular localization of Ras and other potential substrates in ERF2 mutant backgrounds .

  • Genetic suppression screens: Identifying genetic interactions that can bypass the requirement for ERF2-mediated palmitoylation.

Structural Biology Approaches:

  • X-ray crystallography or cryo-EM: Determining the three-dimensional structure of the ERF2-ERF4 complex alone or in association with substrates.

  • Hydrogen-deuterium exchange mass spectrometry: Mapping protein interaction surfaces between ERF2 and its substrates.

These complementary approaches can provide comprehensive insights into ERF2's substrate specificity and mechanism of action.

What protocols are most effective for the transformation of K. lactis with ERF2-expressing vectors?

Effective transformation of K. lactis with ERF2-expressing vectors can be achieved using the following protocol:

Materials:

  • K. lactis GG799 competent cells (characterized by high cell density growth and efficient expression of foreign proteins)

  • Linearized pKLAC1-based expression vector containing the ERF2 gene

  • Appropriate selection media (typically containing acetamide as the sole nitrogen source for selection of transformants)

Procedure:

  • Vector construction:

    • Clone the ERF2 gene into the pKLAC1 vector using appropriate restriction enzymes

    • For example, use BglII and SalI restriction sites as demonstrated in similar recombinant K. lactis work

    • Linearize the construct before transformation

  • Transformation:

    • Transform the linearized construct into K. lactis GG799 competent cells

    • The pKLAC1 vector integrates into the LAC4 promoter region of the K. lactis genome

    • Selection is typically performed on YCB medium containing acetamide

  • Verification:

    • Confirm successful integration by PCR verification

    • Use primers specific to the integrated expression cassette and flanking genomic regions

    • Verify by DNA sequencing to ensure the correct sequence is integrated

  • Expression screening:

    • Screen transformants for protein expression using appropriate induction conditions

    • Typically, galactose is used for induction of the LAC4 promoter in the pKLAC1 system

This approach has been successfully used for the expression of various recombinant proteins in K. lactis, including enzymes with similar complexity to ERF2 .

How can the expression of recombinant ERF2 in K. lactis be optimized?

Optimization of recombinant ERF2 expression in K. lactis can be achieved through several strategies:

Genetic Optimization:

  • Codon optimization: Adjust the ERF2 coding sequence to match K. lactis codon usage preferences

  • Signal sequence selection: Test different secretion signal sequences if secretion is desired

  • Promoter selection: The LAC4 promoter is commonly used, but other promoters may offer different expression characteristics

  • Tag addition: Addition of tags like GST can increase solubility of easily aggregated proteins

Culture Conditions Optimization:

  • Media composition:

    • Carbon source: Typically glucose for growth and galactose for induction

    • Nitrogen source: Complex sources like yeast extract often yield better results

    • Salt composition: Optimize based on preliminary expression tests

  • Induction parameters:

    • Timing: Determine optimal cell density for induction

    • Inducer concentration: Optimize galactose concentration

    • Temperature: Lower temperatures (20-25°C) may improve proper folding

    • pH: Maintain optimal pH range (typically 5.5-7.0)

  • Growth strategy:

    • Batch cultivation: Simpler but may yield lower protein amounts

    • Fed-batch: Controlled nutrient feeding can increase cell density and productivity

    • Continuous culture: For sustained production over longer periods

Example Optimization Table:

ParameterTested RangeOptimal ConditionImpact on Expression
Induction OD6000.5-5.02.0Balance between cell density and metabolic activity
Induction Temperature15-30°C25°CHigher temperatures increase expression rate but may reduce proper folding
Galactose Concentration0.1-2%1%Sufficient for induction without metabolic burden
pH4.5-7.56.0Optimal for protein stability and cell growth
Growth Time24-120h72hMaximum protein accumulation before degradation

These optimization approaches have been successfully applied to various recombinant proteins in K. lactis and can be adapted specifically for ERF2 expression .

How should control experiments be designed when studying ERF2 function?

When designing experiments to study ERF2 function, appropriate controls are critical for valid interpretation of results:

Genetic Controls:

  • Wild-type strain: Include the unmodified parent K. lactis strain to establish baseline cellular functions and protein expression levels.

  • Empty vector control: Transform K. lactis with the expression vector lacking the ERF2 gene to account for effects of the vector itself and the transformation process.

  • Catalytic mutant: Express an ERF2 variant with mutations in the DHHC domain (particularly the cysteine residue) to distinguish between catalytic and structural roles of the protein.

  • ERF4 knockout/knockdown: Compare ERF2 function in the presence and absence of ERF4 to understand their functional relationship .

Biochemical Controls:

  • No-substrate control: In palmitoylation assays, include reactions without substrate proteins to measure background palmitoylation or hydrolysis.

  • No-enzyme control: Include reactions without the ERF2-ERF4 complex to establish baseline non-enzymatic palmitoylation.

  • Heat-inactivated enzyme: Use heat-denatured ERF2 to distinguish enzymatic activity from non-specific effects.

Experimental Design Table:

Experimental GroupERF2 StatusERF4 StatusExpected OutcomePurpose
Wild-typePresentPresentNormal palmitoylationBaseline activity
ERF2 knockoutAbsentPresentNo palmitoylationConfirm ERF2 necessity
ERF2 DHHC mutantCatalytic mutantPresentNo palmitoylationConfirm catalytic role
ERF4 knockoutPresentAbsentReduced palmitoylation, ERF2 instabilityAssess ERF4 dependency
ERF2 overexpressionOverexpressedPresentPotential increased palmitoylationAssess rate limitation
ERF2+ERF4 overexpressionOverexpressedOverexpressedMaximum palmitoylationOptimal activity assessment

This comprehensive control framework ensures that observed effects can be accurately attributed to ERF2 function rather than experimental artifacts or secondary effects .

What approaches can be used to investigate the subcellular localization of ERF2 in K. lactis?

Understanding the subcellular localization of ERF2 is critical for elucidating its function. Several complementary approaches can be employed:

Fluorescence Microscopy Techniques:

  • Fluorescent protein tagging: Generate recombinant K. lactis expressing ERF2 fused to fluorescent proteins (GFP, mCherry, etc.) to visualize its localization in living cells.

  • Immunofluorescence microscopy: Use antibodies against ERF2 or epitope tags (if tagged ERF2 is used) for fixed-cell localization studies.

  • Co-localization studies: Simultaneously visualize ERF2 and known organelle markers to determine precise subcellular compartmentalization.

Biochemical Fractionation:

  • Differential centrifugation: Separate cellular components based on size and density, followed by Western blotting to detect ERF2 in different fractions.

  • Sucrose gradient fractionation: Achieve finer separation of membrane compartments to precisely identify ERF2-containing membranes.

  • Protease protection assays: Determine the topology of ERF2 within membranes by assessing susceptibility to proteases with or without membrane permeabilization.

Advanced Microscopy Approaches:

  • Super-resolution microscopy: Techniques like STORM or PALM can provide nanoscale resolution of ERF2 localization beyond the diffraction limit.

  • Live-cell imaging: Monitor dynamic changes in ERF2 localization in response to various stimuli or during the cell cycle.

  • FRET/BRET analysis: Investigate protein-protein interactions between ERF2 and potential partners in specific subcellular compartments.

Based on research with yeast palmitoyltransferases, ERF2 would be expected to localize primarily to the endoplasmic reticulum membranes, where it participates in the palmitoylation of Ras proteins . Confirmation of this localization in K. lactis would provide important insights into the conservation of this mechanism across yeast species.

How can CRISPR/Cas9 gene editing be applied to study ERF2 function in K. lactis?

CRISPR/Cas9 technology offers powerful approaches for investigating ERF2 function in K. lactis through precise genetic modifications:

Gene Knockout/Knockdown Strategies:

  • Complete ERF2 deletion: Generate an ERF2 null mutant to establish the physiological consequences of complete loss of function.

  • Conditional knockdown: Implement an inducible CRISPR interference (CRISPRi) system to gradually reduce ERF2 expression and identify threshold requirements.

  • ERF4 manipulation: Generate ERF4 knockouts or knockdowns to study the differential effects on ERF2 stability and function .

Precise Genome Editing Applications:

  • Point mutations: Introduce specific mutations in the DHHC domain to dissect the catalytic mechanism without disrupting protein structure.

  • Domain swapping: Replace domains of ERF2 with corresponding regions from other DHHC proteins to investigate specificity determinants.

  • Tagging at endogenous locus: Insert fluorescent protein or epitope tags directly at the genomic ERF2 locus to study the native protein while maintaining natural expression levels.

Implementation Strategy for K. lactis:

  • Design optimized guide RNAs specific to K. lactis ERF2 locus

  • Construct expression vectors containing Cas9 and sgRNA under appropriate K. lactis promoters

  • Include donor DNA templates for homology-directed repair when precise modifications are desired

  • Transform K. lactis with the CRISPR components using established protocols

  • Screen transformants for successful editing via PCR, sequencing, or phenotypic assays

K. lactis has been successfully edited using CRISPR/Cas9, making this a viable approach for studying ERF2 function . The application of this technology allows unprecedented precision in genetic manipulation and will enable researchers to answer fundamental questions about ERF2 structure-function relationships.

What are the potential applications of recombinant K. lactis strains expressing engineered ERF2 variants?

Recombinant K. lactis strains expressing engineered ERF2 variants offer diverse research and biotechnological applications:

Research Applications:

  • Substrate specificity studies: Engineered ERF2 variants with modified substrate binding domains could help identify determinants of substrate recognition.

  • Structure-function analysis: Systematic mutation of specific residues can provide detailed insights into the catalytic mechanism of palmitoylation.

  • Regulatory studies: Creating variants resistant to ERF4-dependent regulation could help dissect the complex interplay between these proteins .

Biotechnological Applications:

  • Protein modification tool: Engineered ERF2 variants with broader substrate specificity could serve as biotechnological tools for site-specific protein palmitoylation.

  • Biosensors: ERF2-based biosensors could be developed to detect protein-protein interactions or monitor cellular palmitoylation dynamics.

  • Therapeutic protein production: The K. lactis expression system has advantages for production of therapeutic proteins, and ERF2 engineering could be used to control the lipidation status of these proteins when desired.

Metabolic Engineering:

  • Lipid metabolism manipulation: ERF2 engineering could potentially redirect cellular fatty acid utilization toward specific pathways.

  • Signaling pathway modulation: Since palmitoylation affects numerous signaling proteins, engineered ERF2 variants could be used to selectively modify cellular signaling networks.

The GRAS status of K. lactis makes it particularly valuable for applications where food safety is a concern , and the established protocols for recombinant protein expression provide a solid foundation for these advanced applications .

What strategies can address low expression levels of recombinant ERF2 in K. lactis?

Low expression of recombinant ERF2 in K. lactis can be addressed through multiple strategies:

Genetic Optimization:

  • Codon optimization: Adjust the coding sequence to match K. lactis preferred codons, particularly for rare amino acids.

  • Promoter selection: Test alternative promoters; while the LAC4 promoter is common, others might yield higher expression for specific proteins.

  • Vector copy number: Increase the copy number of integrated expression cassettes through repeated transformation or selecting multi-integrants.

  • Fusion partners: Add solubility-enhancing fusion tags like GST, which has been shown to increase expression of aggregation-prone proteins .

Expression Conditions:

  • Induction optimization:

    • Timing: Induce at optimal cell density (typically OD600 of 1.0-2.0)

    • Temperature: Lower temperature during induction (20-25°C)

    • Duration: Extend induction time (24-72 hours)

  • Media formulation:

    • Carbon source: Test different concentrations of galactose for induction

    • Supplements: Add amino acids, vitamins, or trace elements to support protein production

    • pH control: Maintain optimal pH throughout cultivation (typically 5.5-6.5)

Protein Stabilization:

  • Co-expression of ERF4: Since ERF4 is required for ERF2 stability , co-expression may significantly improve ERF2 yield.

  • Protease inhibitors: Add protease inhibitors to culture medium or during cell lysis to prevent degradation.

  • Chaperone co-expression: Co-express molecular chaperones to assist proper folding.

Troubleshooting Flowchart:

  • Verify gene sequence and integration → incorrect sequence may cause expression failure

  • Confirm transcription by RT-PCR → absence suggests promoter issues

  • Check for intracellular protein by Western blot → presence indicates expression but possible secretion issue

  • Test different culture conditions → systematic optimization of parameters

  • Implement genetic modifications → more substantial intervention if other approaches fail

By systematically addressing these aspects, researchers can significantly improve recombinant ERF2 expression levels in K. lactis .

How can researchers verify the functionality of recombinant ERF2 expressed in K. lactis?

Verifying the functionality of recombinant ERF2 expressed in K. lactis requires multiple complementary approaches:

Biochemical Activity Assays:

  • Autopalmitoylation assay: Measure the incorporation of radioactive or clickable palmitate analogs into ERF2 itself, which is the first step in the palmitoylation reaction .

  • Palmitoyl transfer assay: Quantify the transfer of palmitate from ERF2 to known substrate proteins such as Ras2, representing the complete palmitoylation reaction .

  • Palmitoyl-CoA hydrolysis assay: Monitor the rate of palmitoyl-CoA hydrolysis, which increases in the absence of substrate proteins or when ERF2 function is compromised .

Cellular Assays:

  • Complementation analysis: Test whether the recombinant ERF2 can rescue phenotypes of ERF2-deficient yeast strains, such as mislocalization of Ras proteins .

  • Substrate localization: Examine whether ERF2 expression restores proper membrane localization of palmitoylated proteins like Ras in deficient strains .

  • Palmitoylation state analysis: Use techniques like acyl-biotin exchange (ABE) or metabolic labeling to assess cellular protein palmitoylation levels.

Protein-Protein Interaction Assays:

  • Co-immunoprecipitation with ERF4: Verify that recombinant ERF2 properly interacts with ERF4, which is essential for its function .

  • Binding assays with substrate proteins: Confirm interaction with known substrates like Ras proteins.

Functional Readout Systems:

Assay TypeMeasurementExpected Result for Functional ERF2Control Comparison
Autopalmitoylation3H-palmitate incorporation into ERF2Significant signal above backgroundMinimal signal with DHHC mutant
Substrate palmitoylation3H-palmitate transfer to Ras2Dose-dependent substrate palmitoylationNo transfer with DHHC mutant
ComplementationRas localization in erf2Δ yeastRestoration of membrane localizationNo restoration with empty vector
Protein stabilityERF2 levels with/without ERF4Increased stability with ERF4Degradation without ERF4

These varied approaches provide comprehensive verification of recombinant ERF2 functionality, ensuring that the expressed protein accurately represents the native enzyme's activity .

How does K. lactis ERF2 compare functionally to its homologs in other yeast species?

A comparative analysis of K. lactis ERF2 with homologs from other yeast species reveals important insights about functional conservation and specialization:

Structural Comparison:
While detailed structural information about K. lactis ERF2 is limited in the provided search results, studies of palmitoyltransferases across yeast species show conserved features including:

  • DHHC domain conservation: All functional homologs contain the characteristic DHHC-CRD motif essential for catalytic activity .

  • Membrane topology: ERF2 proteins typically contain multiple transmembrane domains with the DHHC motif positioned on the cytoplasmic face of the membrane.

  • ERF4 dependency: The requirement for an auxiliary subunit (ERF4/SHR5) appears to be conserved, at least between S. cerevisiae and K. lactis .

Functional Comparison with S. cerevisiae:

  • Substrate specificity: S. cerevisiae ERF2 primarily palmitoylates Ras proteins. While K. lactis ERF2 is expected to perform similar functions, subtle differences in substrate preference may exist due to evolutionary divergence.

  • Regulatory mechanisms: In S. cerevisiae, ERF2 stability and function are regulated by ERF4. This relationship is likely conserved in K. lactis, though the degree of dependency may vary .

  • Subcellular localization: S. cerevisiae ERF2 localizes to the endoplasmic reticulum. K. lactis ERF2 is expected to share this localization, though this would need experimental confirmation .

Evolutionary Context:
K. lactis has emerged as a complementary model to S. cerevisiae for studying cellular processes. As a predominantly respiratory yeast (unlike the fermentative S. cerevisiae), K. lactis may exhibit differences in the regulation of pathways influenced by palmitoylation, particularly those affected by oxygen availability and metabolism .

The mammalian counterpart of ERF2, DHHC9, also requires an auxiliary protein (GCP16) for Ras palmitoylation activity , suggesting that this regulatory mechanism is evolutionarily conserved beyond yeasts to higher eukaryotes.

What are the key differences between expression of ERF2 in K. lactis versus other common expression systems?

Expressing ERF2 in K. lactis offers distinct advantages and challenges compared to other expression systems:

Comparison with S. cerevisiae:

  • Protein secretion: K. lactis typically achieves higher levels of protein secretion than S. cerevisiae, potentially beneficial for downstream purification .

  • Growth characteristics: K. lactis is Crabtree-negative (unlike S. cerevisiae), allowing for higher biomass yield on glucose and potentially higher protein production .

  • Post-translational modifications: Both yeasts perform similar glycosylation patterns, though K. lactis tends to add fewer mannose residues, potentially resulting in less hyperglycosylation.

Comparison with Pichia pastoris:

  • Expression levels: P. pastoris can sometimes achieve higher expression levels, but K. lactis offers easier genetic manipulation and well-established expression systems.

  • Growth requirements: P. pastoris often requires methanol for induction, while K. lactis uses galactose, which is safer and easier to handle.

  • Scale-up: Both systems can be scaled up effectively, though K. lactis may have advantages in certain industrial settings.

Comparison with E. coli:

  • Post-translational modifications: K. lactis, as a eukaryote, can perform proper folding and modifications of ERF2 that the prokaryotic E. coli cannot.

  • Membrane protein expression: ERF2, being a transmembrane protein, is likely to be expressed more functionally in K. lactis than in E. coli, where membrane proteins often form inclusion bodies.

  • Cofactor requirements: K. lactis naturally provides ERF4, which is required for ERF2 stability and function , while this would need to be co-expressed in E. coli.

Comparison with Mammalian Cells:

  • Simplicity and cost: K. lactis is significantly less expensive and easier to culture than mammalian cells.

  • Scale-up potential: K. lactis can be grown to higher densities and larger volumes more easily than mammalian cells.

  • Glycosylation patterns: Mammalian cells provide human-like glycosylation, which may not be necessary for ERF2 function but could be relevant if the protein interacts with human partners.

The food-grade status of K. lactis (GRAS) also provides regulatory advantages for certain applications, making it particularly valuable when the expressed proteins might be used in food or feed industries .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.