Recombinant Kluyveromyces lactis Palmitoyltransferase PFA4 (PFA4)

Shipped with Ice Packs
In Stock

Description

Host Strains and Vectors

Recombinant PFA4 is typically expressed in Kluyveromyces lactis GG799, an industrially robust, food-safe yeast strain . Key vectors include:

  • pKLAC1/pKLAC2: Integrative plasmids with modified LAC4 promoters (PLAC4-PBI) for high-yield expression .

  • Inducible Promoters: The LAC4 promoter is repressed by glucose and induced by galactose, minimizing leaky expression in E. coli during cloning .

Key Advantages of K. lactis Systems

  • Food-Grade Safety: GRAS (Generally Recognized As Safe) status enables use in food and pharmaceutical industries .

  • Secretion Capability: Utilizes the α-mating factor secretion leader for extracellular protein release .

  • Multi-Copy Integration: Linearized plasmids integrate into the LAC4 locus, enabling high-copy expression .

Catalytic Mechanism

PFA4 transfers palmitoyl groups from palmitoyl-CoA to cysteine residues via a two-step process:

  1. Autoacylation of the enzyme’s active-site cysteine.

  2. Transfer of the palmitoyl group to the target protein .

Research Applications

  • Protein Lipidation Studies: Used to investigate S-acylation’s role in cellular signaling and membrane trafficking .

  • Enzyme Engineering: Serves as a template for mutagenesis studies to enhance stability or substrate specificity .

Industrial Potential

  • Biocatalysis: Compatible with K. lactis’s high-density fermentation systems, which achieve >50 g/L cell density .

  • Therapeutic Protein Production: Safe for synthesizing enzymes or vaccines requiring post-translational modifications .

Comparative Analysis of Expression Systems

ParameterK. lactis GG799 E. coli
YieldHigh (mg/L scale)Moderate (µg–mg/L scale)
Post-Translational ModificationsSupported (e.g., glycosylation)Limited
Toxicity MitigationLow background expressionRequires leaky promoter suppression

Research Challenges and Innovations

  • Toxicity Management: Modified LAC4 promoters (e.g., PLAC4-PBI) prevent unintended gene expression in E. coli during plasmid assembly .

  • Autoinduction Systems: Hybrid promoters like P350 enable carbon source–dependent induction, eliminating the need for exogenous inducers .

Future Directions

  • Structural Resolution: X-ray crystallography or cryo-EM studies to elucidate substrate-binding dynamics.

  • Metabolic Engineering: Optimize K. lactis strains for higher PFA4 titers using CRISPR-based genome editing .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All protein shipments are sent with standard blue ice packs. If you require dry ice packaging, please inform us in advance as an additional fee will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
PFA4; KLLA0C06204g; Palmitoyltransferase PFA4; Protein S-acyltransferase; PAT; Protein fatty acyltransferase 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-377
Protein Length
full length protein
Species
Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)
Target Names
PFA4
Target Protein Sequence
MAIKLKNRWLGVAIPAFLVALIGYGSHYFILSNFLSWNEQIFYQTCQTMIWVSYYLAIYT NPGIPPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNF PHFMRFLFWVIFSTAYLLFLLIGRIYLLWSIRHTAFHHRSTSEIIFICIMTPMDAFVLLT VSSLLGRCIYNQCLHGMTQIESWEMDRIQSLHYKNRLLAQVIDRLVERRPEILPAKQHEI NKLLSKRYVNQEDFTNFPYDVNPWTNINNAMGPWYLWLWPWSKPPTIGTSFAKNELFFYD PNSSIEDMLMSLPWPPDGLTHHSRALGSGSSIETIVSGGEQVIRDKSVDLRDRLGRNSWY NDWGEDLSDFGVDTELE
Uniprot No.

Target Background

Function
Recombinant Kluyveromyces lactis Palmitoyltransferase PFA4 (PFA4) mediates the reversible addition of palmitate to target proteins, thereby regulating their membrane association and biological function.
Database Links
Protein Families
DHHC palmitoyltransferase family, PFA4 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

Overview of K. lactis as an Expression System

Kluyveromyces lactis has emerged as a powerful yeast expression system for heterologous proteins with several advantages over other systems. K. lactis is generally regarded as safe (GRAS status), genetically tractable, has a fully sequenced genome, and can produce high titers of heterologous proteins . Unlike methylotrophic yeasts such as Pichia pastoris that require methanol induction, K. lactis can express proteins in simple growth media, making it particularly suitable for industrial-scale protein production . The system has been utilized successfully for over 15 years in large-scale (100-m³) fermentation of recombinant proteins for commercial applications . The ability to integrate expression vectors into the K. lactis genome at the LAC4 locus provides stable expression strains without the need for continuous selective pressure.

What expression vectors are suitable for recombinant PFA4 production in K. lactis?

The pKLAC1 vector is a primary choice for heterologous protein expression in K. lactis. This 9,091 bp vector combines several key features that make it particularly effective for PFA4 expression . The vector contains the K. lactis LAC4 promoter, which has been modified to remain transcriptionally silent in E. coli, allowing for the cloning of potentially toxic proteins . The vector includes an α-mating factor secretion domain that can be fused to the N-terminus of the target protein, directing it to the secretory pathway .

For experimental implementation, researchers should consider the following methodological approach:

  • Clone the PFA4 gene into the multiple cloning site (MCS) of pKLAC1, ensuring in-frame fusion with the α-mating factor secretion domain.

  • Linearize the construct with SacII or BstXI prior to transformation.

  • The linearized vector will integrate into the K. lactis chromosome at the LAC4 locus.

  • Select transformants using acetamide as the sole nitrogen source on defined medium, leveraging the acetamidase selectable marker (amdS) expressed from the yeast ADH1 promoter .

A critical advantage of pKLAC1 is that when cleaved with SacII or BstXI, the recombinant protein and selectable marker become flanked by two halves of the LAC4 promoter, facilitating homologous recombination with the LAC4 locus in the K. lactis chromosome .

How should researchers optimize PFA4 expression conditions in K. lactis?

Optimizing expression of recombinant PFA4 in K. lactis requires systematic evaluation of several parameters:

Selection Method:
Acetamide selection has been demonstrated to yield transformant populations almost completely comprised of strains with multiple tandem insertions of the expression vector at the LAC4 chromosomal locus, whereas G418 selection typically results in only 16% of transformants having multiple integrations . The average copy number within transformant populations can double when acetamide is used for selection compared to G418 . Therefore, for high-level PFA4 expression, acetamide selection is strongly recommended.

Integration Strategy:
For optimal expression, researchers should:

  • Create SacII or BstXI linearized vectors to target integration at the LAC4 locus.

  • Screen multiple transformants by whole-cell PCR to identify those with multiple vector integrations.

  • Compare expression levels among different clones to select high-producers.

Culture Conditions:
K. lactis can express proteins in simple growth medium, which provides an advantage over methylotrophic yeasts that require methanol induction . For PFA4 expression, start with YPD (1% yeast extract, 2% peptone, 2% dextrose) medium for biomass generation, followed by transition to expression medium containing appropriate carbon sources to induce the LAC4 promoter.

What purification strategies are effective for recombinant K. lactis PFA4?

Purification of recombinant K. lactis PFA4 requires specialized approaches due to its transmembrane nature. Based on the information provided, the following purification strategy is recommended:

Affinity Chromatography:
Expressing PFA4 with an N-terminal His-tag allows for immobilized metal affinity chromatography (IMAC) purification . The protocol should include:

  • Cell lysis in a buffer containing mild detergents (e.g., 1% Triton X-100 or n-dodecyl β-D-maltoside) to solubilize membrane proteins.

  • Binding to Ni-NTA resin in the presence of low concentrations of imidazole (10-20 mM) to reduce non-specific binding.

  • Washing with increasing concentrations of imidazole.

  • Elution with high imidazole concentration (250-500 mM).

Storage Recommendations:
The purified protein should be stored in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 . For long-term storage, add glycerol to a final concentration of 50% and store at -20°C or -80°C in small aliquots to avoid repeated freeze-thaw cycles . Working aliquots can be stored at 4°C for up to one week .

Reconstitution Protocol:
If the protein is provided as a lyophilized powder, centrifuge the vial briefly before opening and reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

How can multiple copies of PFA4 be integrated into the K. lactis genome?

The integration of multiple copies of the PFA4 expression cassette can significantly enhance protein yield. The acetamide selection system offers a powerful approach to enrich for transformants with multiple tandem integrations . The methodology involves:

  • Vector Design: Use pKLAC1 with the PFA4 gene inserted in the MCS and linearize with SacII or BstXI.

  • Transformation and Selection: Transform K. lactis GG799 competent cells with the linearized vector and plate on yeast carbon base medium with acetamide as the sole nitrogen source .

  • Selection Advantage: The acetamide selection method creates strong selective pressure for cells with multiple vector copies. This occurs because cells with more copies of the acetamidase gene (amdS) can metabolize acetamide more efficiently, creating a growth advantage .

  • Screening for Multi-Copy Integrants:

    • Extract genomic DNA from individual transformants

    • Perform quantitative PCR to determine the copy number using primers specific to the integrated expression cassette

    • Select clones with the highest copy numbers for further analysis

Research has shown that acetamide selection yields transformant populations nearly completely comprised of strains with multiple tandem insertions, whereas only 16% of G418-selected transformants contain multiple integrations . Additionally, the average copy number within acetamide-selected populations is double that of G418-selected populations .

What approaches can be used to study the functional domains of PFA4?

Investigating the functional domains of PFA4 requires a multifaceted approach combining molecular biology, biochemistry, and structural analysis:

Site-Directed Mutagenesis:

  • Identify conserved residues in the PFA4 sequence, particularly within the DHHC domain and other catalytically important regions.

  • Design primers for site-directed mutagenesis of these residues.

  • Construct a series of point mutants in the pKLAC1 vector.

  • Express the mutant proteins in K. lactis and assess their enzymatic activity.

Domain Mapping:

  • Generate a series of truncation constructs removing different portions of the PFA4 protein.

  • Express these constructs in K. lactis and assess their localization and activity.

  • Use this information to map domains essential for activity, membrane association, and protein-protein interactions.

Structural Analysis:
The transmembrane nature of PFA4 makes structural determination challenging. Consider:

  • Crystallography of soluble domains

  • Cryo-electron microscopy for full-length protein

  • In silico modeling based on homologous proteins

Functional Assays:
Develop assays to measure palmitoylation activity:

  • In vitro assays using purified protein and fluorescently labeled palmitoyl-CoA

  • Cell-based assays monitoring palmitoylation of known substrates

  • Pulse-chase experiments to measure palmitate turnover on substrate proteins

How does expression of PFA4 in K. lactis compare to other expression systems?

Comparing PFA4 expression across different platforms requires consideration of multiple factors:

K. lactis vs. E. coli Expression:

FeatureK. lactisE. coli
Post-translational modificationsYes, eukaryotic modificationsLimited, bacterial modifications
Membrane protein foldingBetter for eukaryotic membrane proteinsOften results in inclusion bodies
Expression levelModerate to highCan be very high
ScalabilityExcellent, simple mediaExcellent, inexpensive
Endotoxin concernsNone, GRAS organismEndotoxin removal needed

K. lactis vs. Other Yeast Systems:

FeatureK. lactisPichia pastorisSaccharomyces cerevisiae
InductionConstitutive (LAC4 promoter)Methanol-inducibleVarious options
Growth rateFastModerateFast
Media complexitySimpleRequires methanolSimple
HyperglycosylationLess than S. cerevisiaeLess than S. cerevisiaeCan be excessive
Integration stabilityHigh, LAC4 locusHigh, AOX1 locusVariable

K. lactis has been extensively used as a host for heterologous protein expression for over 15 years . It offers several advantages, including GRAS status, simple growth medium requirements, and the ability to achieve high-titer protein production without the need for methanol induction . The system is particularly well-suited for industrial-scale production, as demonstrated by its 15-year history in 100-m³ scale fermentation of recombinant proteins .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.