Recombinant Kluyveromyces lactis Peroxisome assembly protein 22 (PEX22)

Shipped with Ice Packs
In Stock

Description

General Information

PEX22 is crucial for the correct localization and function of other peroxins, such as PEX4. It acts as a docking protein, facilitating the interaction between PEX4 and the peroxisomal membrane . This interaction is essential for the ubiquitination of proteins, a process that marks them for degradation or regulates their function in peroxisome biogenesis .

Data Collection and Refinement Statistics for Arabidopsis thaliana PEX4-PEX22 Structure

StatisticsValue
Resolution (Å)(See source)
R-factor Free(See source)
Space Group(See source)
Unit Cell Dimensions (Å)(See source)
Number of Reflections(See source)
R-work(See source)
Wilson B-factor (Å^2)(See source)
Buried surface area (BSA) of PEX4793 Å^2
Buried surface area (BSA) of PEX22728 Å^2

Functional Significance

  1. Peroxisome Assembly: PEX22 is essential for the early stages of peroxisome assembly. It functions in conjunction with other peroxins to facilitate the formation of functional peroxisomes .

  2. Protein Recruitment: PEX22 recruits other proteins to the peroxisomal membrane. It is a docking protein that is important for the interaction between PEX4 and the peroxisomal membrane .

  3. Ubiquitination: By facilitating the interaction between PEX4 and the peroxisomal membrane, PEX22 is indirectly involved in the ubiquitination of proteins, a process that is important for regulating protein function and degradation in peroxisomes .

  4. Role in fungal development: In Fusarium graminearum, deletion of PEX22-like impacts conidiation, conidial germination and sexual reproduction .

PEX4-PEX22 Complex

PEX22 forms a complex with PEX4, which is critical for the function of both proteins . The PEX4-PEX22 complex has been studied in various organisms, including Hansenula polymorpha and Arabidopsis thaliana . The interface between PEX4 and PEX22 is stabilized by salt bridges formed by conserved residues .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for your use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PEX22; KLLA0F00308g; Peroxisome assembly protein 22; Peroxin-22
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)
Target Names
PEX22
Target Protein Sequence
MRGDKETTNWLNKSLMKQARQKKLSIIAVGVLSTVAVTVGYLLYLYRGQRNPNIRDVKPK SKCYVLTQDLFDKIENWQEELSKDSVMLVLPEVAHLGNHLKLQLSSIEHKIVIFNNSSAV WSAVRHLKKYELVISRDKTSDMPVDLRRYVGQISHI
Uniprot No.

Target Background

Function
Involved in peroxisome biogenesis.
Database Links
Protein Families
Peroxin-22 family
Subcellular Location
Peroxisome membrane; Single-pass membrane protein.

Q&A

What is the fundamental role of PEX22 in peroxisome biogenesis?

PEX22 is a crucial peroxin involved in peroxisome membrane protein (PMP) targeting and sorting. It functions primarily as a membrane anchor for other peroxins in the protein import machinery. Research indicates that PEX22, along with PEX3 and PEX19, is involved in the indirect pathway of PMP sorting, where these proteins are first targeted to the endoplasmic reticulum (ER) before being incorporated into pre-peroxisomal vesicles (PPVs) .

The protein participates in a multi-step process where:

  • PMPs are first targeted to a specialized region of the ER (peroxisomal-ER; pER)

  • PEX19-dependent vesicle formation occurs

  • These vesicles (PPVs) bud off from the ER

  • Eventually mature into functional peroxisomes

This ER-to-peroxisome trafficking pathway has been confirmed in multiple yeast species including K. lactis, S. cerevisiae, and O. polymorpha, indicating a conserved mechanism .

How should researchers design experiments to study PEX22 function in K. lactis?

When designing experiments to study PEX22 function in K. lactis, consider the following methodology:

Initial Experimental Design Steps:

  • Clearly define your variables:

    • Independent variable: PEX22 expression/mutation status

    • Dependent variable: Peroxisome formation/function metrics

    • Control variables: Growth conditions, cell density, strain background

  • Implement appropriate controls:

    • Positive control: Wild-type K. lactis with normal PEX22 expression

    • Negative control: PEX22 deletion mutant (pex22Δ)

    • System control: K. lactis expressing a non-functional PEX22 mutant

  • Choose appropriate experimental methods:

    • Gene deletion/mutation techniques

    • Fluorescence microscopy for peroxisome visualization

    • Biochemical assays for peroxisomal enzyme activities

    • Protein-protein interaction studies (co-immunoprecipitation, yeast two-hybrid)

Important considerations:

  • K. lactis has different growth requirements than S. cerevisiae, particularly regarding oxygen availability. It cannot grow under strictly anoxic conditions but can ferment sugars and grow in hypoxic conditions (below 1% oxygen) .

  • The phenotype of peroxin mutants can vary between yeast species. For example, while PEX30 deletion in S. cerevisiae increases peroxisome numbers, in K. phaffii it results in fewer, clustered peroxisomes .

What expression systems are optimal for producing recombinant K. lactis PEX22?

Several expression systems can be used to produce recombinant K. lactis PEX22, each with specific advantages:

E. coli Expression System:

  • Most commonly used for initial studies

  • Typically uses T7 promoter-based vectors with His-tag or other fusion partners

  • Expression in E. coli yields full-length protein (1-156 aa) with N-terminal His-tag

  • Form: Typically lyophilized powder following purification

  • Storage buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Yeast Expression Systems:

  • S. cerevisiae or K. lactis itself for homologous expression

  • Integrative or episomal vectors can be used

  • Consider using the self-inducible heterologous protein expression (SILEX) system for higher yields

Advanced Expression Options:

  • For studies requiring proper post-translational modifications, consider:

    • Drosophila S2 cells with vectors like pDroIn or pDroEx (for intracellular or secreted expression)

    • Mammalian expression systems using vectors with CMV promoters

Expression vector selection guide:

HostRecommended VectorPromoterTag OptionsBest Used For
E. colipT7-based vectorsT7His, GST, MBPBasic structural studies
S. cerevisiaepYES2GAL1His, GSTFunctional studies
K. lactispKLAC1LAC4His, FLAGNative environment studies
Drosophila S2pDroExMetallothioneinHis, StrepComplex folding studies

How can researchers investigate PEX22 interactions with other peroxins in the peroxisome assembly pathway?

Investigating PEX22 interactions with other peroxins requires sophisticated methodological approaches:

Protein-Protein Interaction Studies:

  • Co-immunoprecipitation (Co-IP):

    • Express tagged PEX22 in K. lactis

    • Lyse cells under mild conditions to preserve protein complexes

    • Pull down PEX22 using tag-specific antibodies

    • Analyze co-precipitated proteins by mass spectrometry or immunoblotting

  • Bimolecular Fluorescence Complementation (BiFC):

    • Fuse PEX22 and potential interaction partners to complementary fragments of a fluorescent protein

    • Co-express in K. lactis

    • Observe fluorescence restoration when proteins interact in vivo

  • Yeast Two-Hybrid Assay:

    • Create fusion constructs of PEX22 (bait) and potential partners (prey)

    • Screen for protein interactions based on reporter gene activation

    • Validate positive interactions with alternative methods

Localization Studies:

  • Fluorescence Microscopy:

    • Express PEX22-GFP fusion protein

    • Co-localize with ER and peroxisome markers

    • Track trafficking between compartments using time-lapse imaging

  • Subcellular Fractionation:

    • Separate cellular compartments by differential centrifugation

    • Analyze protein distribution by immunoblotting

    • Determine membrane association through carbonate extraction

Key Interaction Partners to Investigate:

  • PEX3: Known to interact with PEX22 during PMP sorting

  • PEX19: Essential for PMP targeting and membrane vesicle formation

  • Components of ESCRT-III complex: Recently identified as required for scission of pre-peroxisomal vesicles from the ER

How does PEX22 function differ in K. lactis compared to other yeast species under hypoxic conditions?

K. lactis has unique responses to hypoxia that differ from S. cerevisiae, which may impact PEX22 function:

K. lactis Hypoxic Response Characteristics:

  • K. lactis cannot grow under strictly anoxic conditions, unlike S. cerevisiae

  • It can ferment sugars and grow in hypoxic conditions (below 1% oxygen)

  • K. lactis lacks the anaerobic sterol import system found in S. cerevisiae

Comparative Hypoxic Gene Regulation:

  • K. lactis shows different patterns of hypoxic gene regulation compared to S. cerevisiae

  • Several genes are upregulated during hypoxia in K. lactis, including KlHEM13, KlHEM1, KlPDC1, KlOYE2, KlGSH1, and KlOLE1

Experimental Approaches to Study PEX22 Under Hypoxia:

  • Gene Expression Analysis:

    • Compare PEX22 transcript levels under normoxic versus hypoxic conditions

    • Use RT-qPCR or RNA-seq approaches

    • Analyze promoter regions for hypoxia-responsive elements

  • Protein Localization and Function:

    • Monitor PEX22-GFP localization under varying oxygen levels

    • Assess peroxisome number, size, and distribution

    • Measure peroxisomal enzyme activities under hypoxic stress

  • Comparative Analysis:

    • Create equivalent PEX22 mutations in both K. lactis and S. cerevisiae

    • Compare phenotypes under normoxic and hypoxic conditions

    • Identify species-specific functions or regulatory mechanisms

Regulatory Mechanism Differences:
The sterol regulatory element binding proteins Upc2 and Ecm22, which control hypoxic gene expression in S. cerevisiae, may have different functions in K. lactis. This regulatory circuit remains unstudied in K. lactis, although analysis of the genome sequence shows conservation of hypoxic genes from the sterol biosynthetic pathway in both yeasts .

What are common challenges when purifying recombinant K. lactis PEX22 and how can they be addressed?

Researchers frequently encounter several challenges when purifying recombinant PEX22:

Challenge 1: Poor Solubility

  • Cause: PEX22 contains a transmembrane domain that may cause aggregation

  • Solutions:

    • Use fusion partners known to enhance solubility (MBP, GST, Trx)

    • Optimize expression temperature (try 16-20°C)

    • Add mild detergents (0.1% Triton X-100, 0.5% CHAPS) to extraction buffers

    • Consider using a truncated version without the transmembrane domain for structural studies

Challenge 2: Low Expression Yield

  • Cause: Toxicity to host cells or codon usage incompatibility

  • Solutions:

    • Try different expression systems (E. coli, yeast, insect cells)

    • Optimize codon usage for the expression host

    • Use autoinduction media for E. coli expression

    • Consider the SILEX system for higher yields through self-induction

Challenge 3: Protein Degradation

  • Cause: Proteolytic activity during extraction and purification

  • Solutions:

    • Add protease inhibitor cocktail to all buffers

    • Work at 4°C throughout purification

    • Minimize the time between cell lysis and final purification

    • Add stabilizing agents like glycerol (6-50%) to storage buffer

Recommended Purification Protocol:

  • Express His-tagged PEX22 in E. coli

  • Lyse cells in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 0.1% Triton X-100, and protease inhibitors

  • Bind to Ni-NTA resin

  • Wash with increasing imidazole concentrations

  • Elute with 250 mM imidazole

  • Perform buffer exchange to remove imidazole

  • Store in Tris/PBS-based buffer with 6% Trehalose or 50% glycerol at -20°C/-80°C

Reconstitution Guidelines:
For lyophilized protein:

  • Centrifuge the vial briefly before opening

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to 5-50% final concentration (50% recommended)

  • Aliquot for long-term storage at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles

How can researchers validate the functionality of purified recombinant PEX22?

Validating the functionality of purified recombinant PEX22 is essential to ensure that experimental results are reliable:

Basic Validation Methods:

  • SDS-PAGE and Western Blotting:

    • Confirm protein purity (>90% recommended)

    • Verify correct molecular weight

    • Use anti-His or anti-PEX22 antibodies for detection

  • Mass Spectrometry:

    • Confirm protein identity through peptide mass fingerprinting

    • Identify potential post-translational modifications

Functional Validation Approaches:

  • In vitro Binding Assays:

    • Test interaction with known binding partners (PEX3, PEX19)

    • Use techniques such as pull-down assays or surface plasmon resonance

    • Compare binding kinetics with published data

  • Complementation Assays:

    • Transform PEX22-deficient yeast strains with the recombinant protein

    • Assess rescue of peroxisome biogenesis

    • Measure restoration of peroxisomal enzyme activities

  • Membrane Integration Assays:

    • Verify insertion into artificial liposomes

    • Confirm proper topology using protease protection assays

    • Analyze membrane interaction dynamics

Advanced Validation Methods:

  • Structural Analysis:

    • Circular dichroism to assess secondary structure integrity

    • Limited proteolysis to confirm proper folding

    • Thermal shift assays to measure protein stability

  • Functional Reconstitution:

    • Reconstitute with other peroxins in liposomes

    • Test formation of protein complexes in vitro

    • Assess vesicle budding capacity in minimal systems

The validation approach should be tailored to the specific research question being addressed, and multiple validation methods should ideally be used to confirm functionality from different perspectives.

How can researchers leverage K. lactis PEX22 studies for understanding peroxisome membrane contact sites?

Recent research has highlighted the importance of membrane contact sites (MCS) between peroxisomes and other organelles, offering new research directions:

Significance of Peroxisome Membrane Contact Sites:

  • MCS are crucial for peroxisome biogenesis, membrane growth, and peroxisome inheritance

  • They facilitate lipid transfer, metabolite exchange, and signaling between organelles

  • PEX22 may participate in these contact sites, directly or indirectly

Methodological Approaches to Study PEX22 in Membrane Contact Sites:

  • Proximity Labeling Techniques:

    • Fuse PEX22 to enzymes like BioID or APEX2

    • Identify proximal proteins at contact sites

    • Analyze temporal dynamics of these interactions

  • Super-Resolution Microscopy:

    • Use techniques like STED or PALM to visualize contact sites at nanoscale resolution

    • Co-localize PEX22 with markers for other organelles

    • Quantify contact site formation under different conditions

  • Lipid Transfer Assays:

    • Develop in vitro systems to study lipid movement between membranes

    • Investigate if PEX22 facilitates or regulates this process

    • Monitor changes in membrane composition

Related Proteins to Investigate:

  • Pex11: Originally known for its role in peroxisome fission, recent studies indicate it functions as a contact site protein

  • Pex30 and Pex32: Initially thought to be peroxisomal proteins, now recognized as ER-resident proteins that may coordinate peroxisome-ER contacts

  • ESCRT-III complex: Required for scission of pre-peroxisomal vesicles from the ER

These emerging research directions could significantly expand our understanding of PEX22's broader role in cellular organization and inter-organelle communication.

What novel experimental approaches can be used to study PEX22 trafficking from the ER to peroxisomes?

Investigating the dynamic process of PEX22 trafficking from the ER to peroxisomes requires innovative methodological approaches:

Advanced Imaging Techniques:

  • Live-Cell Time-Lapse Imaging:

    • Express PEX22-fluorescent protein fusions

    • Use spinning disk confocal microscopy for rapid acquisition

    • Track protein movement in real-time

    • Quantify trafficking kinetics and directionality

  • Fluorescence Recovery After Photobleaching (FRAP):

    • Selectively bleach peroxisome-localized PEX22-GFP

    • Monitor fluorescence recovery rate

    • Calculate protein mobility and exchange rates

    • Compare wild-type to mutant variants

  • Pulse-Chase Imaging with Photoactivatable Proteins:

    • Fuse PEX22 to photoactivatable fluorescent proteins

    • Activate specifically at the ER

    • Track newly synthesized protein movement to peroxisomes

    • Measure trafficking rates under different conditions

Biochemical and Genetic Approaches:

  • Temporally Controlled Expression Systems:

    • Use inducible promoters to trigger PEX22 expression

    • Take time-point samples after induction

    • Perform subcellular fractionation

    • Analyze redistribution between ER and peroxisomal fractions

  • Vesicle Isolation and Characterization:

    • Develop methods to isolate PPVs

    • Characterize protein and lipid composition

    • Investigate the role of ESCRT-III in vesicle formation

    • Reconstitute vesicle budding in vitro

  • Targeted Protein Mislocalization:

    • Add specific targeting signals to redirect PEX22

    • Assess effects on peroxisome biogenesis

    • Identify critical trafficking determinants

    • Map interaction domains with trafficking machinery

These methodological approaches provide researchers with powerful tools to dissect the complex, multi-step process of PEX22 trafficking and its role in peroxisome biogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.