Recombinant Kluyveromyces lactis pH-response regulator palI/RIM9 homolog 2 (KLLA0C05060g)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Characteristics

The KLLA0C05060g gene encodes a 225-amino-acid protein (UniProt ID: Q6CUG3) with a molecular weight of approximately 25.5 kDa. Key features include:

AttributeDetails
Gene NameKLLA0C05060g
Alternative NamespH-response regulator palI/RIM9 homolog 2; hypothetical protein
SpeciesKluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
Amino Acid SequenceFull sequence provided in : MLVKIVLVVLLTLALVFECFSTISVPITIGLYISEYNGYRFGVFGWCKVDRSVCSPIRIGYSKDDILLFNEQEYLHLPNHAKYALSNLLLVHVLAFVCVTILWVFGMLTCFRCIKTSRRMLIIAVLWSMLTFMVTLLGFLIDILIFSSHVTWCTWLTLASAFFTVLSGTVLCVMRRNLTYDKFLESKPEKHGVYVPLCRLNDVEELEIPWCNTMNHQALTAPTPM
FunctionPutative role in pH-dependent signaling pathways (homology to palI/RIM9 proteins)

Production and Expression Methods

The protein is generated using heterologous expression systems, often leveraging K. lactis’s robust genetic tools:

Key Production Strategies

  1. Vector Design

    • pKLAC1/pKLAC2 Vectors: Used for gene cloning and integration into the K. lactis genome at the LAC4 locus .

    • CRISPR/Cas9 Editing: Employed to delete native invertase genes, enhancing heterologous protein yields .

  2. Expression Optimization

    • Induction Media: Galactose > lactose for LAC4 promoter activation .

    • Scalability: Geometric similarity in bioreactors improved oxygen transfer rates, boosting transferase activity by 159% .

Functional Insights and Gaps

  • Homology to palI/RIM9: In Saccharomyces cerevisiae, RIM9 regulates alkaline pH response by activating the Rim101 pathway . KLLA0C05060g likely shares conserved roles in pH sensing.

  • Experimental Challenges: Limited data on its biochemical interactions (e.g., kinase activity, substrate specificity).

Comparative Analysis of Recombinant pH-Response Regulators

ProteinHostPurityTagApplication
KLLA0C05060gE. coli≥90%HisImmunoassays, structural studies
S. cerevisiae RIM9S. cerevisiae≥85%NativepH response signaling
E. nidulans palIE. coli≥85%NoneHypothetical pH regulation

Future Directions

  • Functional Characterization: In vitro assays to map pH-dependent interactions.

  • Industrial Applications: Leveraging K. lactis’s scalable production for biologics (e.g., vaccines, enzymes) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes and we will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize its development.
Synonyms
KLLA0C05060g; pH-response regulator palI/RIM9 homolog 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-225
Protein Length
full length protein
Species
Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)
Target Names
KLLA0C05060g
Target Protein Sequence
MLVKIVLVVLLTLALVFECFSTISVPITIGLYISEYNGYRFGVFGWCKVDRSVCSPIRIG YSKDDILLFNEQEYLHLPNHAKYALSNLLLVHVLAFVCVTILWVFGMLTCFRCIKTSRRM LIIAVLWSMLTFMVTLLGFLIDILIFSSHVTWCTWLTLASAFFTVLSGTVLCVMRRNLTY DKFLESKPEKHGVYVPLCRLNDVEELEIPWCNTMNHQALTAPTPM
Uniprot No.

Target Background

Function
This protein is essential for the proteolytic cleavage of the transcription factor RIM101 in response to alkaline ambient pH.
Database Links
Protein Families
PalI/RIM9 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is KLLA0C05060g and what is its function in Kluyveromyces lactis?

KLLA0C05060g is a pH-response regulator palI/RIM9 homolog 2 from Kluyveromyces lactis, functioning as part of cellular pH sensing mechanisms . This membrane protein consists of 225 amino acids and appears to contain multiple hydrophobic regions characteristic of transmembrane domains, suggesting it spans the membrane multiple times . Based on its amino acid sequence (mLVKIVLVVLLTLALVFECFSTISVPITIGLYISEYNGYRFGVFGWCKVDRSVCSPIRIGYSKDDILLFNEQEYLHLPNHAKYALSNLLLVHVLAFVCVTILWVFGmLTCFRCIKTSRRMLIIAVLWSmLTFMVTLLGFLIDILIFSSHVTWCTWLTLASAFFTVLSGTVLCVMRRNLTYDKFLESKPEKHGVYVPLCRLNDVEELEIPWCNTMNHQALTAPTPM), it likely plays a role in cellular pH homeostasis by sensing environmental pH changes and triggering appropriate cellular responses .

While K. lactis has emerged as an important yeast species for research and industrial biotechnology, particularly for its ability to achieve high levels of protein secretion, the specific role of KLLA0C05060g in pH regulation pathways remains an active area of investigation .

What expression systems are most suitable for producing recombinant KLLA0C05060g?

The most established system for producing recombinant KLLA0C05060g is E. coli with a His-tag fusion for purification purposes . When designing expression constructs, researchers should consider:

  • Codon optimization: Harmonizing codon usage with the expression host to maximize protein production

  • Signal peptide manipulation: Potential removal of native signal sequences that might interfere with heterologous expression

  • Fusion tag selection: While His-tags are commonly used, other tags (GST, MBP) may increase solubility of membrane proteins

  • Induction conditions: Temperature, inducer concentration, and duration require optimization for membrane proteins

The expression in K. lactis itself may also be advantageous for studying native function, as it provides appropriate post-translational modifications and membrane composition . For membrane proteins like KLLA0C05060g, detergent screening during purification is critical to maintain structural integrity .

How should KLLA0C05060g be stored and handled in laboratory settings?

Optimal storage conditions for purified recombinant KLLA0C05060g include:

Storage ConditionRecommendationDurationNotes
Short-term storage4°CUp to one weekIn working aliquots to avoid freeze-thaw cycles
Medium-term storage-20°CSeveral monthsIn Tris-based buffer with 50% glycerol
Long-term storage-80°CYearsIn Tris-based buffer with 50% glycerol

Repeated freeze-thaw cycles should be strictly avoided as they can denature the protein and reduce its activity . For working with the protein, researchers should prepare small working aliquots stored at 4°C for up to one week . The protein is typically maintained in a Tris-based buffer with 50% glycerol, which has been optimized for this specific protein's stability .

What methodologies are most effective for studying the pH-response regulatory function of KLLA0C05060g?

To investigate the pH-response regulatory function of KLLA0C05060g, researchers should implement a multi-faceted approach:

  • pH-dependent activity assays: Develop in vitro systems to measure protein conformational changes or binding affinities across a pH gradient (pH 4-8). Techniques such as tryptophan fluorescence spectroscopy can detect subtle structural changes in response to pH shifts.

  • Site-directed mutagenesis: Target conserved histidine residues (which often function as pH sensors due to their pKa values) to determine critical residues for pH sensing. Each mutation should be followed by functional characterization.

  • Gene knockout and complementation studies: Create KLLA0C05060g deletion strains and assess their growth and viability under varying pH conditions. Complementation with wild-type and mutant variants can provide insights into structure-function relationships.

  • Transcriptomics approach: Employ RNA-seq to identify genes differentially expressed in wild-type versus KLLA0C05060g mutant strains under pH stress, revealing potential downstream targets of this regulator.

  • Electrophysiology techniques: For membrane proteins involved in ion transport or sensing, patch-clamp techniques can determine if the protein functions as an ion channel or modifies membrane potential in response to pH changes.

These methodologies should be applied systematically, starting with phenotypic characterization of knockout strains and progressing to more detailed mechanistic investigations.

How can researchers design experiments to investigate protein-protein interactions involving KLLA0C05060g?

Investigating protein-protein interactions (PPIs) involving KLLA0C05060g requires specialized approaches for membrane proteins:

  • Membrane-based yeast two-hybrid (MYTH) system: Unlike conventional Y2H systems, MYTH is specifically designed for membrane proteins. The bait protein (KLLA0C05060g) is fused to a split-ubiquitin moiety, allowing detection of interactions occurring at or within membranes.

  • Co-immunoprecipitation with crosslinking: Prior to cell lysis, membrane-permeable crosslinkers (such as DSP or formaldehyde) can stabilize transient interactions. After solubilization with gentle detergents, the protein complex can be immunoprecipitated using antibodies against KLLA0C05060g or its fusion tag.

  • Bimolecular Fluorescence Complementation (BiFC): By fusing split fluorescent protein fragments to KLLA0C05060g and potential interaction partners, researchers can visualize interactions in vivo through reconstitution of fluorescence when proteins interact.

  • Proximity-dependent biotin identification (BioID): Fusion of KLLA0C05060g with a promiscuous biotin ligase allows biotinylation of proteins in close proximity, which can then be purified and identified by mass spectrometry.

  • Surface Plasmon Resonance (SPR): For validating direct interactions, purified KLLA0C05060g can be immobilized on sensor chips in the presence of appropriate detergents, and potential binding partners flowed over to measure binding kinetics.

Each method has specific advantages and limitations, making a combination approach most effective for comprehensive characterization of the KLLA0C05060g interactome.

What approaches are recommended for analyzing the membrane localization and topology of KLLA0C05060g?

To determine the membrane localization and topology of KLLA0C05060g, researchers should consider these methodological approaches:

  • Fusion protein localization: Creating GFP/YFP fusions with KLLA0C05060g allows visualization of subcellular localization through fluorescence microscopy. N-terminal and C-terminal fusions should be tested separately to minimize interference with targeting signals.

  • Protease protection assays: After isolating membrane fractions containing KLLA0C05060g, treatment with proteases (e.g., trypsin, proteinase K) in the presence or absence of membrane-permeabilizing detergents can identify which protein domains are exposed on each side of the membrane.

  • Substituted cysteine accessibility method (SCAM): Sequential introduction of cysteine residues throughout the protein, followed by labeling with membrane-impermeable sulfhydryl reagents, reveals which regions are accessible from which side of the membrane.

  • Glycosylation mapping: Introduction of artificial N-glycosylation sites at various positions can determine luminal/cytoplasmic orientation, as glycosylation only occurs in the ER lumen.

  • Cryo-electron microscopy: For high-resolution structural information, cryo-EM of purified KLLA0C05060g reconstituted in nanodiscs or lipid vesicles can reveal membrane topology and domain organization.

How can researchers compare the function of KLLA0C05060g with its homologs in other yeast species?

Comparative functional analysis of KLLA0C05060g with its homologs requires a systematic approach:

  • Phylogenetic analysis: Construct a comprehensive phylogenetic tree of palI/RIM9 homologs across fungal species to establish evolutionary relationships and identify potentially divergent functions.

  • Heterologous complementation: Express KLLA0C05060g in deletion mutants of corresponding genes in other yeast species (e.g., S. cerevisiae) to assess functional conservation. This approach has been successfully used with other K. lactis genes such as KlLEU4, which can complement Scleu4Δ Scleu9Δ leucine auxotrophy .

  • Domain swap experiments: Create chimeric proteins by exchanging functional domains between KLLA0C05060g and its homologs to determine which regions confer specific functional properties or species-specific adaptations.

  • Comparative transcriptomics: Perform RNA-seq under identical pH stress conditions across multiple yeast species with and without their respective palI/RIM9 homologs to identify conserved and divergent regulatory networks.

  • Biochemical property comparison: Directly compare pH sensitivity, binding partners, and regulatory mechanisms of purified homologs from different species using identical in vitro assays.

K. lactis and S. cerevisiae provide an excellent comparative model system, as they diverged before the whole genome duplication event that occurred in the S. cerevisiae lineage . This evolutionary distance allows researchers to study how pH response mechanisms have adapted to different ecological niches.

What are common challenges in purifying recombinant KLLA0C05060g and how can they be addressed?

Purification of membrane proteins like KLLA0C05060g presents several challenges that can be addressed with specific strategies:

ChallengeSolutionMethodology
Low expression levelsOptimize codon usageRedesign coding sequence using preferential codons for expression host
Protein aggregationScreen detergent conditionsTest panel of detergents (DDM, LMNG, CHAPS) at varying concentrations for solubilization
Loss of function during purificationIncorporate stabilizing agentsAdd specific lipids or small molecule ligands during purification
Protein heterogeneitySize exclusion chromatographyRemove aggregates and ensure monodispersity before functional assays
Low purity after IMACOptimize imidazole gradientUse shallow gradients and additional purification steps (ion exchange, SEC)

When designing purification protocols, researchers should note that the His-tagged version of KLLA0C05060g has been successfully expressed in E. coli . The purification buffer should be carefully optimized with respect to pH, salt concentration, and glycerol content to maintain protein stability throughout the process .

How can researchers troubleshoot experiments involving KLLA0C05060g knockout strains?

When working with KLLA0C05060g knockout strains in K. lactis, researchers may encounter several challenges:

For gene disruption in K. lactis, homologous recombination using the kanMX4 cassette has been successfully employed for other genes and could be adapted for KLLA0C05060g . The knockout design should include verification of proper integration at both 5' and 3' junctions.

What are the appropriate methodologies for investigating post-translational modifications of KLLA0C05060g?

Investigation of post-translational modifications (PTMs) of KLLA0C05060g requires specialized analytical approaches:

  • Mass spectrometry-based PTM mapping: Employ high-resolution MS/MS following enzymatic digestion to identify phosphorylation, ubiquitination, acetylation, or other modifications. For membrane proteins, special consideration must be given to extraction and digestion protocols.

  • PTM-specific antibodies: Develop or obtain antibodies that recognize specific PTMs (e.g., phospho-specific antibodies) for immunoblotting analysis under different cellular conditions.

  • Site-directed mutagenesis of PTM sites: Mutate potential modification sites (S/T/Y for phosphorylation) to non-modifiable residues (typically A for S/T, F for Y) and assess functional consequences.

  • In vitro modification assays: Incubate purified KLLA0C05060g with kinases, acetyltransferases, or other modifying enzymes to determine potential enzymatic partners.

  • Temporal dynamics of modifications: Implement pulse-chase labeling with stable isotopes combined with MS to monitor the kinetics of modification acquisition and removal.

Given that KLLA0C05060g functions as a pH-response regulator, phosphorylation events might be particularly relevant for its activation or deactivation in response to environmental pH changes, and should be a priority focus for PTM analysis.

How can researchers develop antibodies or other detection reagents specific to KLLA0C05060g?

Developing specific detection reagents for KLLA0C05060g involves several strategic approaches:

  • Epitope selection: Analyze the protein sequence to identify regions with high antigenicity and surface accessibility. For membrane proteins like KLLA0C05060g, focus on hydrophilic loops that likely extend into aqueous environments.

  • Peptide antibodies: Synthesize peptides (15-20 amino acids) corresponding to unique regions of KLLA0C05060g, conjugate to carrier proteins, and immunize rabbits or other animals. Multiple peptides should be tested to increase success probability.

  • Recombinant fragment antibodies: Express soluble domains of KLLA0C05060g as separate immunogens, avoiding hydrophobic transmembrane regions that may cause aggregation.

  • Nanobody development: Generate single-domain antibodies (nanobodies) through immunization of camelids, which often provide better access to conformational epitopes in membrane proteins.

  • Verification strategies: Validate antibody specificity using KLLA0C05060g knockout strains as negative controls and overexpression systems as positive controls. Cross-reactivity with homologous proteins should be carefully assessed.

For non-antibody detection methods, consider developing aptamers or engineered binding proteins, which can sometimes offer advantages in detecting specific conformational states of membrane proteins like KLLA0C05060g.

How might CRISPR/Cas9 technology be applied to study KLLA0C05060g function?

CRISPR/Cas9 technology offers powerful approaches for investigating KLLA0C05060g function:

  • Precise genome editing: Create clean knockouts, point mutations, or tagged versions of KLLA0C05060g at the endogenous locus without leaving selection markers that might affect neighboring genes. This approach is particularly valuable for membrane proteins where expression levels can critically affect function.

  • CRISPRi for conditional knockdown: Deploy catalytically inactive Cas9 (dCas9) fused to repressor domains to achieve tunable repression of KLLA0C05060g expression, allowing study of partial loss-of-function.

  • CRISPRa for overexpression: Use dCas9 fused to activation domains to increase endogenous expression, avoiding artifacts associated with plasmid-based overexpression.

  • Base editing: Apply cytosine or adenine base editors to introduce specific amino acid changes without double-strand breaks, enabling high-throughput mutagenesis of potential functional residues.

  • CRISPR screens: Develop sgRNA libraries targeting regions around KLLA0C05060g to identify regulatory elements or genes functionally connected to its pH-responsive pathways.

CRISPR/Cas9 has been successfully applied in K. lactis, as noted in the literature on strain design for this industrially important yeast . This technology could be particularly valuable for creating precise mutations in KLLA0C05060g to analyze structure-function relationships in its native context.

What integrative approaches can be used to place KLLA0C05060g in the broader context of cellular pH homeostasis?

To understand KLLA0C05060g's role in cellular pH homeostasis, researchers should implement integrative approaches:

  • Systems biology modeling: Develop mathematical models incorporating KLLA0C05060g and related pH regulators to predict system-wide responses to pH perturbations. These models should integrate transcriptomic, proteomic, and metabolomic data.

  • Multi-omics integration: Combine transcriptomics, proteomics, and metabolomics analyses of wild-type and KLLA0C05060g mutant strains under various pH conditions to identify all molecular pathways affected by this regulator.

  • Comparative genomics across pH-tolerant yeasts: Analyze gene conservation, synteny, and evolutionary patterns of pH-response systems across yeast species with different pH tolerance profiles to identify core and species-specific mechanisms.

  • In vivo pH measurements: Employ genetically encoded pH sensors (like pHluorin) targeted to different cellular compartments to measure real-time pH changes in response to environmental shifts in wild-type and KLLA0C05060g mutant strains.

  • Synthetic biology approaches: Create minimal pH-responsive circuits incorporating KLLA0C05060g and its immediate interactors to define the essential components required for pH sensing and response.

By placing KLLA0C05060g in this broader cellular context, researchers can move beyond individual protein characterization to understand its role in the complex network of pH homeostasis mechanisms that allow K. lactis to adapt to environmental challenges.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.