Recombinant Kluyveromyces lactis Presequence translocated-associated motor subunit PAM17, mitochondrial (PAM17)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Kluyveromyces lactis Presequence Translocated-Associated Motor Subunit PAM17, Mitochondrial (PAM17)

Recombinant Kluyveromyces lactis Presequence Translocated-Associated Motor Subunit PAM17, Mitochondrial (PAM17), is a protein component of the presequence translocase-associated motor (PAM), which drives the translocation of preproteins into the mitochondrial matrix . PAM17 is involved in an early stage of protein translocation, cooperating with Tim44 to facilitate protein import into the mitochondria . It interacts with the channel protein Tim23, creating a new interaction site between TIM23 and PAM .

Functional Role in Mitochondrial Protein Import

PAM17 is essential for the architecture and translocation activity of the mitochondrial protein import motor . Mitochondria lacking Pam17 show impaired import of matrix proteins and reduced import-driving activity of PAM . It is required for the stable complex formation between the cochaperones Pam16 and Pam18 and promotes the association of Pam16-Pam18 with the presequence translocase .

  • Posttranslational Protein Import: PAM17 is involved in posttranslational protein import into mitochondria .

  • Interaction with Tim44 and Tim23: Pam17 interacts with Tim44 and Tim23, which are crucial components of the TIM23 complex . The inactivation of Tim44 enhances the association of Pam17 with the TIM23 complex .

  • Role in Preprotein Translocation: Pam17 is required for the import-driving activity of PAM, which facilitates the translocation of preproteins across the mitochondrial inner membrane .

Genetic and Mutant Studies

Studies involving pam17Δ (deletion of the PAM17 gene) have provided insights into its function .

  • pam17Δ mitochondria exhibit import defects with certain matrix-targeted precursors .

  • A synthetic enhancement of phenotypic effects occurs when PAM17 is deleted in combination with mutants of essential genes like SSC1 and TIM44 .

  • In tim44 mutant mitochondria, Pam17 accumulates at the TIM23 complex, indicating a functional relationship between these proteins .

Role in the Import Motor Complex

Pam17 functions as a subunit of the presequence translocase-associated motor (PAM), which includes mtHsp70, Mge1, Tim44, and the Pam16-Pam18 complex . It is required for the correct organization of the Pam16-Pam18 complex and contributes to the regulation of mtHsp70 activity at the inner membrane translocation site .

Experimental Evidence

  • Posttranslational Import Assay: In pam17Δ cells, the import of preMdj1 (a mitochondrial J-protein) is significantly reduced compared to wild-type cells, confirming PAM17's role in posttranslational protein import .

Table 2: Impact of PAM17 on Preprotein Import

Cell TypePrecursor Amount at 0 Minutes (%)Precursor Amount at 45 Minutes (%)
Wild Type21.32.7
pam17Δ28.314.9
  • Co-precipitation Studies: Pam17 co-precipitates with Tim23, indicating a direct interaction or close proximity within the TIM23 complex .

  • Cross-linking Experiments: Cross-linking experiments confirm that inactivation of Tim44 enhances the association of Pam17 with the TIM23 complex .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
PAM17; KLLA0A06083g; Presequence translocated-associated motor subunit PAM17, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
34-196
Protein Length
Full Length of Mature Protein
Species
Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)
Target Names
PAM17
Target Protein Sequence
RMNSTNAGKTASHEMTWPEFFKLRKKERVFNTASSVATAIVFVNGSWFYFSTLEIDPTQT IFGFDPLMAITAGMITCAAVGWLLGPIVGTALFKATSGPKLLQFQEKQLSFLAKIQKNRV NPQSQSFSNPVPDYYGEKINSIPQYRQWLRDCHSYKRKASEFL
Uniprot No.

Target Background

Function

Component of the PAM complex, essential for ATP-dependent translocation of transit peptide-containing proteins from the inner mitochondrial membrane to the matrix.

Database Links
Protein Families
PAM17 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the functional significance of PAM17 in Kluyveromyces lactis?

PAM17 in K. lactis functions as a subunit of the presequence translocase-associated motor complex in mitochondria. It plays a critical role in the import of nuclear-encoded proteins into the mitochondria, particularly those destined for the mitochondrial matrix. Unlike Saccharomyces cerevisiae, K. lactis has a predominantly respiratory metabolism, making mitochondrial import mechanisms particularly significant for its cellular function . The protein facilitates the translocation of preproteins across the inner mitochondrial membrane, contributing to the maintenance of mitochondrial proteostasis and respiratory function.

How does K. lactis PAM17 differ from its homologs in other yeast species?

K. lactis PAM17 shares structural similarities with PAM17 homologs in other yeasts, particularly S. cerevisiae, but exhibits distinct functional characteristics reflective of K. lactis' respiratory metabolism. While the core protein translocation machinery is conserved across yeast species, K. lactis shows differential regulation of mitochondrial proteins compared to fermentative yeasts like S. cerevisiae . Sequence alignment analysis reveals conserved functional domains essential for interaction with other components of the protein import machinery, but with species-specific variations that may reflect the adaptation to respiratory metabolism in K. lactis.

What expression systems are available for studying recombinant K. lactis PAM17?

Recombinant K. lactis PAM17 can be expressed in various systems, including bacterial (E. coli), yeast (S. cerevisiae or K. lactis itself), and insect cell expression systems. For research applications, the protein is typically expressed with appropriate tags to facilitate purification and detection . When expressing in heterologous systems, researchers should optimize codon usage and culture conditions to ensure proper folding and post-translational modifications. Expression in the native K. lactis offers advantages for maintaining physiological relevance but may yield lower protein quantities compared to optimized heterologous systems.

How does oxidative stress affect PAM17 function in K. lactis mitochondria?

The function of PAM17 in K. lactis mitochondria is likely affected by oxidative stress conditions, given the known relationship between hypoxia and oxidative stress response in this yeast . Under oxidative stress, several mitochondrial proteins, including components of protein import machinery, may undergo oxidative modifications that alter their function. Methodologically, researchers can investigate this question by:

  • Exposing K. lactis cultures to controlled oxidative stress conditions (H₂O₂ treatment, menadione, or hypoxia-reoxygenation)

  • Assessing PAM17 protein levels, post-translational modifications, and interaction partners before and after stress

  • Measuring mitochondrial protein import efficiency using in vitro import assays with isolated mitochondria

  • Analyzing respiratory function and ROS production in PAM17 mutants compared to wild-type strains under stress conditions

These approaches can reveal how oxidative stress modulates PAM17 activity and its broader implications for mitochondrial function during stress adaptation.

What is the role of PAM17 in hypoxic adaptation of K. lactis?

K. lactis exhibits distinct hypoxic responses compared to S. cerevisiae, with different patterns of gene expression regulation under low oxygen conditions . While PAM17 itself has not been extensively characterized in hypoxic adaptation, its role in mitochondrial protein import suggests potential involvement in the cellular response to oxygen limitation. To investigate this question:

  • Compare PAM17 expression and localization under normoxic versus hypoxic conditions

  • Generate PAM17 deletion or conditional mutants and assess their growth and respiratory metabolism under varying oxygen levels

  • Perform transcriptomic and proteomic analyses to identify changes in mitochondrial protein composition dependent on PAM17 during hypoxia

  • Examine the interaction between PAM17 and known hypoxic response regulators in K. lactis

Understanding PAM17's role in hypoxic adaptation could provide insights into how K. lactis maintains mitochondrial function despite its predominantly respiratory metabolism under oxygen-limited conditions.

How does PAM17 interact with the redox system in K. lactis mitochondria?

The redox environment in K. lactis differs significantly from that in S. cerevisiae, with distinct mechanisms for handling NAD(P)H balance and glutathione metabolism . PAM17's function in mitochondrial protein import may be influenced by these redox systems. A methodological approach to study this interaction includes:

  • Assessing PAM17 function in strains with altered redox metabolism (GLR deletion mutants, thioredoxin system mutants)

  • Determining if PAM17 itself undergoes redox-sensitive modifications using redox proteomics approaches

  • Measuring mitochondrial protein import efficiency under different redox conditions

  • Analyzing the structural consequences of altered redox status on PAM17 conformation and interactions

This investigation would provide insights into how mitochondrial protein import machinery adapts to the unique redox metabolism of K. lactis.

What are the optimal conditions for purification of recombinant K. lactis PAM17?

Purification of recombinant K. lactis PAM17 requires careful consideration of protein stability and solubility. The recommended protocol includes:

  • Expression System Selection:

    • E. coli BL21(DE3) for high yield

    • K. lactis for native modifications

  • Purification Strategy:

    • Affinity chromatography using appropriate tags (His-tag recommended)

    • Size exclusion chromatography for higher purity

    • Ion exchange chromatography as a polishing step

  • Buffer Optimization:

    • Base buffer: 50 mM Tris-HCl, pH 7.5-8.0

    • Salt: 150-300 mM NaCl to maintain solubility

    • Addition of 10% glycerol to prevent aggregation

    • Consider adding reducing agents (1-5 mM DTT or 2-10 mM β-mercaptoethanol)

  • Storage Conditions:

    • Store in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage

    • Avoid repeated freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

This optimized protocol ensures maximal recovery of functional PAM17 protein suitable for downstream applications.

How can researchers effectively generate and characterize PAM17 knockout mutants in K. lactis?

Creating and characterizing PAM17 knockout mutants in K. lactis involves several methodological steps:

  • Knockout Strategy:

    • Homologous recombination using selection markers (KanMX, URA3)

    • CRISPR-Cas9 mediated gene editing for precise modifications

    • Design of guide RNAs targeting the KLLA0A06083g locus

  • Verification Methods:

    • PCR-based genotyping to confirm gene disruption

    • Southern blotting for integration verification

    • qRT-PCR and Western blotting to confirm absence of expression

  • Phenotypic Characterization:

    • Growth assays under different carbon sources and oxygen conditions

    • Respiratory capacity measurements (oxygen consumption)

    • Mitochondrial morphology and membrane potential assessments

    • Protein import assays using isolated mitochondria

  • Complementation Tests:

    • Reintroduction of wild-type PAM17 to verify phenotype rescue

    • Introduction of mutated versions to identify critical residues

This comprehensive approach enables thorough characterization of PAM17's function through loss-of-function studies.

What methods can be used to study PAM17 protein-protein interactions in the mitochondrial import machinery?

Investigating PAM17 interactions within the mitochondrial protein import machinery requires specialized techniques:

  • Co-immunoprecipitation (Co-IP):

    • Tag PAM17 with epitope tags (FLAG, HA, or Myc)

    • Use crosslinking agents to capture transient interactions

    • Immunoprecipitate and identify interacting partners by Western blot or mass spectrometry

  • Proximity-based Labeling:

    • BioID or APEX2 fusion constructs with PAM17

    • In vivo labeling of proximal proteins

    • Purification and identification of labeled proteins

  • Yeast Two-Hybrid Assays:

    • Split-ubiquitin system for membrane protein interactions

    • Modified versions focusing on mitochondrial compartments

  • Structural Biology Approaches:

    • Cryo-EM of purified complexes containing PAM17

    • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

    • In silico molecular docking based on the known amino acid sequence

These methods provide complementary data to build a comprehensive model of PAM17's integration into the mitochondrial protein import machinery.

How should researchers interpret differences in PAM17 function between K. lactis and S. cerevisiae?

When analyzing comparative data on PAM17 function between K. lactis and S. cerevisiae, researchers should consider:

  • Metabolic Context Differences:

    • K. lactis has predominantly respiratory metabolism versus S. cerevisiae's fermentative preference

    • Redox metabolism differs significantly between the species

    • Hypoxic response mechanisms diverge substantially

  • Evolutionary Perspective:

    • K. lactis and S. cerevisiae diverged before the whole genome duplication event

    • Functional conservation versus species-specific adaptations

  • Experimental Considerations:

    • Growth conditions may affect comparability (standardize oxygen levels, carbon sources)

    • Consider using cross-complementation experiments to assess functional equivalence

    • Perform experiments in parallel under identical conditions

  • Data Interpretation Framework:

    • Distinguish core conserved functions from species-specific adaptations

    • Consider the broader context of mitochondrial import machinery

    • Relate functional differences to metabolic strategies

This interpretive framework helps place PAM17 functional differences in their proper evolutionary and physiological context.

What statistical approaches are most appropriate for analyzing PAM17 expression data across different experimental conditions?

For robust analysis of PAM17 expression data:

  • Normalization Methods:

    • Use multiple reference genes validated for stability in K. lactis

    • Consider global normalization methods for transcriptome-wide studies

    • Apply appropriate transformation (log2) for expression ratio data

  • Statistical Tests:

    • For comparing two conditions: Student's t-test with appropriate corrections

    • For multiple conditions: ANOVA followed by post-hoc tests (Tukey's HSD)

    • For time-course experiments: repeated measures ANOVA or mixed-effects models

  • Visualization Approaches:

    • Box plots showing distribution of expression values

    • Heatmaps for multi-condition experiments

    • Volcano plots for differential expression analysis

  • Bioinformatic Integration:

    • Pathway enrichment analysis to contextualize PAM17 expression changes

    • Co-expression network analysis to identify functionally related genes

    • Comparison with datasets from related organisms

These analytical approaches ensure robust interpretation of expression data while accounting for biological and technical variability.

How can PAM17 studies in K. lactis inform understanding of mitochondrial disease models?

Research on K. lactis PAM17 can contribute to understanding human mitochondrial diseases through:

  • Translational Relevance:

    • K. lactis' respiratory metabolism more closely resembles human cells than S. cerevisiae does

    • Mitochondrial protein import defects underlie several human diseases

  • Disease Modeling Approaches:

    • Introduce disease-associated mutations in conserved domains of PAM17

    • Study consequences for respiratory function and cell viability

    • Use humanized versions of PAM17 in K. lactis to directly test human variants

  • Therapeutic Screening Applications:

    • K. lactis PAM17 mutants can serve as platforms for drug screening

    • Identify compounds that rescue mitochondrial protein import defects

    • Test interventions targeting redox balance in mitochondrial disease models

  • Comparative Analysis Framework:

    • Parallel studies in K. lactis, S. cerevisiae and human cells

    • Identify conserved versus species-specific phenotypes

    • Apply findings from yeast to guide studies in more complex models

This translational approach leverages K. lactis as an effective model for human mitochondrial function and disease.

What can we learn from comparing PAM17 function across respiratory versus fermentative yeasts?

Comparative analysis of PAM17 across yeast species with different metabolic strategies reveals:

  • Functional Adaptations:

    • Respiratory yeasts like K. lactis may require more robust mitochondrial protein import

    • Fermentative yeasts like S. cerevisiae may have different regulatory mechanisms for PAM17

    • Adaptations in protein-protein interactions within the import machinery

  • Methodological Approach:

    • Cross-species complementation experiments

    • Domain swapping to identify functionally divergent regions

    • Comparative analysis of expression patterns and regulation

  • Evolutionary Insights:

    • Tracing the evolution of mitochondrial import machinery

    • Identifying selection pressures related to metabolic strategy

    • Understanding the co-evolution of interacting components

  • Biotechnological Applications:

    • Optimizing mitochondrial function for metabolic engineering

    • Enhancing protein production in recombinant systems

    • Improving stress resistance in industrial yeast strains

These comparative studies provide a deeper understanding of how mitochondrial protein import adapts to different metabolic strategies across evolution.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.