Recombinant Kluyveromyces lactis Protease KEX1 (KEX1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To request a specific tag type, please inform us, and we will prioritize its development.
Synonyms
KEX1; KLLA0D19811g; Protease KEX1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
25-756
Protein Length
Full Length of Mature Protein
Species
Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)
Target Names
KEX1
Target Protein Sequence
KKDHENRQYFAIESYDDVGNLLAEHSDWSFEHDVRGLANHYVFSKPLQSLGKRDAIDTGY SENIIDFHDLPPVQLHKRLPIGDSSMEQIQNARILFNISDPLFDQQWHLINPNYPGNDVN VTGLWKENITGYGVVAALVDDGLDYENEDLKDNFCVEGSWDFNDNNPLPKPRLKDDYHGT RCAGEIAAFRNDICGVGVAYNSKVSGIRILSGQITAEDEAASLIYGLDVNDIYSCSWGPS DDGKTMQAPDTLVKKAIIKGVTEGRDAKGALYVFASGNGGMFGDSCNFDGYTNSIFSITV GAIDWKGLHPPYSESCSAVMVVTYSSGSGNYIKTTDLDEKCSNTHGGTSAAAPLAAGIYT LVLEANPNLTWRDVQYLSILSSEEINPHDGKWQDTAMGKRYSHTYGFGKLDAYNIVHMAK SWINVNPQGWLYLPTIVEKQSISNSDEVIESTVSVSAEEFKQNNLKRLEHVTVTVDIDAP YRGHVLVDLISPDGVTSTLATARRLDKNRYGFQNWTFMSVAHWGSSGVGSWKLKVKSTHD NEIVTLKSWRLKMFGETIDAKKAKVISYGNDKEDAEVKSTESKTTTPTAQTSSFTTTSGE ETSGANKLPRPEQAAQLYLAIFVIGAIVIIIYYLFFLKSRRIIRRSRAEAYEFDIIDTDS EYDSSINQTAESISGEVNDDNLEDFNFDINEEELSPRESSSNNPFGNESLESFDNSPDHT SNLLGQNSIPNK
Uniprot No.

Target Background

Function

Likely involved in the processing of m1-toxin and alpha-factor precursors.

Database Links
Protein Families
Peptidase S8 family, Furin subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the genetic structure and cellular location of the KEX1 gene and protein in Kluyveromyces lactis?

KEX1 is a chromosomal gene in Kluyveromyces lactis that encodes a subtilisin-type serine proteinase essential for the production of killer toxin, which is encoded by the linear DNA plasmid pGKL-1 . The KEX1 protein is 700 amino acids in length and contains two critical structural elements: an internal domain with significant homology to subtilisin-type proteinases, and a transmembrane domain located near the carboxyl terminus that anchors the protein within cellular membranes .

The gene has been successfully cloned by complementation of kex1 mutations using a recombinant plasmid pool containing the entire K. lactis genome, with the URA3 gene from Saccharomyces cerevisiae serving as a selection marker . Sequence analysis reveals that while KEX1 shares limited but significant sequence homology with the KEX2 gene of S. cerevisiae, functional studies demonstrate their related roles in protein processing pathways .

How does KEX1 functionally compare to similar proteases in other yeast species?

KEX1 from K. lactis shares functional characteristics with the KEX2 gene product from Saccharomyces cerevisiae, demonstrated through complementation studies. When the KEX1 gene of K. lactis is introduced into S. cerevisiae strains with kex2 mutations, it successfully complements the functional deficiency . Similarly, the KEX2 gene from S. cerevisiae can complement kex1 mutations in K. lactis . This cross-species complementation provides strong evidence for functional conservation despite limited sequence homology.

Unlike some other yeast proteases, KEX1 plays a crucial role in sporulation processes, as K. lactis diploids homozygous for kex1 mutations exhibit significant sporulation deficiencies . This suggests KEX1 has broader physiological functions beyond killer toxin processing, potentially including roles in sexual reproduction pathways that aren't observed with all subtilisin-like proteases.

What are the catalytic mechanisms and substrate specificity of the KEX1 protease?

KEX1 functions as a subtilisin-type serine protease with specific proteolytic activity directed toward dibasic amino acid cleavage sites. The enzyme's catalytic domain contains the classic catalytic triad characteristic of serine proteases, facilitating nucleophilic attack on peptide bonds. Based on functional studies, KEX1 demonstrates primary specificity for lysine-arginine (KR↓) cleavage sites, which is critical for its role in processing precursor proteins in the secretory pathway .

The protease's substrate recognition extends beyond the simple dibasic motif, with experimental evidence suggesting that secondary structural elements in substrate proteins influence processing efficiency. This substrate specificity is exploited in recombinant protein expression systems, where the KR↓ cleavage site is engineered immediately upstream of target proteins to ensure correct processing in the Golgi apparatus .

What role does KEX1 play in the killer toxin system of K. lactis and how is it regulated?

KEX1 is essential for the functional expression of the killer system in K. lactis, which is associated with two linear DNA plasmids, pGKL1 and pGKL2 . While the killer toxin and immunity determinant are encoded by pGKL1, their proper expression requires the chromosomal KEX1 gene . KEX1 functions as a processing protease that cleaves the killer toxin precursor at specific recognition sites, facilitating its maturation into the active toxin form .

The regulation of KEX1 involves both transcriptional and post-translational mechanisms. Mutations in KEX1 block the expression of the killer character, indicating its absolute requirement for toxin production . Furthermore, the physical interaction between KEX1 and the toxin precursor occurs within the secretory pathway, suggesting coordinated regulation with other secretory processes. Experimental disruption of the KEX1 gene demonstrates that it is not only essential for toxin production but also impacts sporulation processes in diploid cells, indicating broader regulatory connections to developmental pathways .

What are the optimal methods for cloning and expressing recombinant KEX1 in laboratory settings?

The optimal cloning strategy for KEX1 involves amplification from K. lactis genomic DNA using high-fidelity DNA polymerase with primers that incorporate appropriate restriction sites for subsequent cloning. Based on published protocols, the following methodology is recommended:

  • Genomic DNA extraction: Use standard yeast genomic DNA extraction protocols with spheroplasting to ensure high-quality template DNA.

  • PCR amplification: Design primers that include:

    • 5' restriction site (commonly XhoI)

    • Kozak sequence for efficient translation

    • 3' restriction site (commonly BglII)

    • Optional epitope tags for detection

  • Vector selection: The pKLAC1 vector system offers significant advantages, as it incorporates:

    • The modified LAC4 promoter (P<sub>LAC4</sub>) with PBI site mutations to prevent premature expression in E. coli

    • The K. lactis α-mating factor secretion signal

    • Multiple cloning sites for directional cloning

    • The LAC4 transcription terminator

  • Transformation protocol: For optimal expression in K. lactis:

    • Linearize the construct with SacII or BstXI before transformation

    • Use acetamide selection (via the amdS marker) for stable integrants

    • Confirm integration by PCR analysis of genomic DNA

This methodology has been successfully applied to express problematic proteins like bovine enterokinase that are typically toxic in E. coli systems .

In Vitro Activity Assays:

  • Fluorogenic peptide substrates: Synthetic peptides containing the KEX1 recognition sequence (KR↓) coupled to fluorogenic groups (e.g., 7-amino-4-methylcoumarin) provide quantitative measurement of proteolytic activity. Activity is measured as an increase in fluorescence when the fluorophore is released upon cleavage.

  • SDS-PAGE analysis of substrate processing: Purified KEX1 is incubated with recombinant protein substrates containing the KR↓ cleavage site, and processing is visualized by size shifts on SDS-PAGE.

  • HPLC analysis: Cleaved peptide products can be separated and quantified using reversed-phase HPLC to determine kinetic parameters.

In Vivo Activity Assessment:

  • Reporter protein systems: Engineer fusion proteins containing:

    • A secretion signal

    • The KEX1 recognition sequence (KR↓)

    • A reporter protein (e.g., human serum albumin)

  • Western blot analysis: Use antibodies against the reporter protein to assess processing efficiency in culture supernatants.

  • Complementation assays: Introduce wild-type KEX1 or variant forms into kex1-deficient strains and measure restoration of killer toxin activity or HSA processing as functional readouts .

For quantitative comparisons, the following data analysis approaches are recommended:

Analytical MethodKey ParametersAdvantagesLimitations
Fluorogenic AssayK<sub>m</sub>, V<sub>max</sub>, k<sub>cat</sub>Quantitative, real-timeLimited to short peptides
SDS-PAGE% ConversionWorks with native substratesSemi-quantitative
Western BlotRelative processing efficiencySensitive, specificAntibody-dependent
Killer Toxin AssayZone of inhibition (mm)Physiologically relevantIndirect measurement

How can researchers engineer KEX1 variants with modified substrate specificity for biotechnological applications?

Engineering KEX1 variants with altered substrate specificity requires systematic structure-guided mutagenesis approaches. Based on experimental evidence, researchers should focus on the following strategies:

  • Catalytic domain modifications: Target residues in the substrate-binding pocket that interact with the P1 and P2 positions (the basic residues K and R). Site-directed mutagenesis of these positions can alter the preference for dibasic motifs to other recognition sequences.

  • Loop engineering: The surface loops that form the substrate-binding cleft can be modified through:

    • Loop grafting from other subtilisin-like proteases with different specificities

    • Combinatorial libraries with randomized loop sequences followed by activity-based screening

  • Directed evolution approach:

    • Generate random mutagenesis libraries using error-prone PCR

    • Develop high-throughput screening systems using fluorogenic substrates with desired target sequences

    • Perform iterative rounds of selection to identify variants with desired specificity

  • Rational design based on structural models:

    • Create homology models based on related subtilisin-like proteases with known structures

    • Identify key substrate-interacting residues through in silico docking

    • Design precise mutations to modify the electrostatic and steric properties of the binding pocket

When testing engineered variants, employ comparative kinetic analysis using diverse substrate panels to characterize changes in specificity. Monitor both k<sub>cat</sub> and K<sub>m</sub> parameters, as successful engineering should maintain catalytic efficiency while altering substrate preference.

What are the current challenges and solutions in using KEX1 for processing complex recombinant proteins with multiple domains?

Processing complex multi-domain proteins with KEX1 presents several challenges that require strategic solutions:

Challenges:

  • Incomplete processing: Large, complex proteins may fold in ways that limit accessibility of KEX1 cleavage sites.

  • Non-specific cleavage: Proteins containing internal KR sequences may experience unwanted proteolysis.

  • Protein aggregation: Partially processed intermediates can form aggregates during secretion.

  • Structural constraints: The context surrounding the KR↓ site influences processing efficiency.

Research-Based Solutions:

  • Optimized cleavage site design:

    • Incorporate extended recognition sequences beyond the minimal KR↓ motif

    • Include flexible linker regions (e.g., Gly-Ser repeats) flanking the cleavage site

    • Position the cleavage site in naturally exposed regions based on structural predictions

  • Co-expression strategies:

    • Modulate KEX1 expression levels relative to substrate protein

    • Co-express chaperones to improve substrate protein folding

  • Process engineering approaches:

    • Optimize culture conditions (pH, temperature, media composition)

    • Implement controlled induction systems for synchronized expression

  • Mutagenesis of problematic internal sites:

    • Replace internal KR sequences with conservative substitutions (KQ or KH)

    • Use site-directed mutagenesis to eliminate non-essential internal cleavage sites

Experimental data indicates that incorporating 2-4 amino acids on either side of the KR↓ sequence from efficiently processed natural substrates significantly improves processing efficiency for complex recombinant proteins .

Problem 1: Low expression levels of active KEX1

Causes:

  • Improper codon usage

  • Protein misfolding

  • Toxicity to host cells

Research-based solutions:

  • Optimize codons for K. lactis expression

  • Lower expression temperature to 20-25°C

  • Use controlled induction with the LAC4 promoter variants that contain mutations in the PBI sequence to prevent premature expression in E. coli

  • Include chaperone co-expression systems

Problem 2: Purification difficulties

Causes:

  • Membrane association via C-terminal domain

  • Protein aggregation

  • Autoproteolytic degradation

Research-based solutions:

  • Create truncated constructs lacking the transmembrane domain

  • Include 0.1-0.5% non-ionic detergents during extraction

  • Add protease inhibitors specific for serine proteases

  • Employ affinity tags (His, FLAG) for single-step purification

  • Perform purification at 4°C to minimize autoproteolysis

Problem 3: Inconsistent protease activity

Causes:

  • Variable glycosylation

  • Improper disulfide bond formation

  • Dependence on specific metal ions

Research-based solutions:

  • Add 1-5 mM calcium to stabilize the protein structure

  • Include redox buffers (GSH/GSSG) during refolding

  • Standardize glycosylation by expression in glycoengineered strains

  • Test activity across buffer conditions (pH 6.0-8.0)

Problem 4: Unexpected cleavage patterns

Causes:

  • Secondary site recognition

  • Substrate conformation effects

  • Co-purifying contaminating proteases

Research-based solutions:

  • Validate KEX1 preparation purity by mass spectrometry

  • Use site-directed mutagenesis to create inactive control (mutation at catalytic serine)

  • Perform cleavage reactions with specific inhibitors to identify contaminating activities

  • Analyze cleavage products by N-terminal sequencing

How can researchers optimize KEX1 expression systems for maximum yield and activity of properly folded protein?

Optimization of KEX1 expression requires integrated approaches addressing transcription, translation, folding, and secretion. Based on experimental evidence with K. lactis expression systems, the following optimization strategy is recommended:

Transcriptional optimization:

  • Promoter selection: The modified LAC4 promoter lacking the PBI sequence provides high-level expression while preventing toxicity in E. coli during cloning steps .

  • Copy number optimization: Multi-copy integration improves yield proportionally with gene dosage, as demonstrated with human serum albumin expression in K. lactis .

  • Induction conditions: For inducible promoters like LAC4, culture with 1-2% galactose in YP medium (YPGal) maximizes induction while maintaining vector stability .

Translational and secretory optimization:

  • Secretion signal selection: The native K. lactis α-mating factor pre-pro domain provides more efficient secretion than heterologous signals for KEX1 expression .

  • Culture conditions table:

ParameterRangeOptimal ConditionEffect on KEX1
Temperature20-30°C25°CBalances expression rate with folding efficiency
pH4.5-6.55.5Maintains stability while allowing for efficient secretion
Dissolved O₂20-80%40%Supports proper disulfide bond formation
Carbon sourceGlucose/Galactose2% GalactoseMaximizes LAC4 promoter activity
Culture time24-96h48-72hAllows complete processing and secretion
  • Media supplementation:

    • Add 5 mM CaCl₂ to stabilize the subtilisin-like domain

    • Include 0.1% casamino acids to reduce proteolytic degradation

    • Supplement with 1% peptone to provide peptide precursors

Integration strategy:

  • Vector design: Use integrative vectors like pKLAC1 for stable expression without antibiotic selection .

  • Selection method: The acetamidase gene (amdS) provides stable selection without antibiotics, improving long-term stability of expression strains .

  • Integration targeting: Direct integration to the LAC4 locus for consistent expression levels and genetic stability.

This optimization approach has demonstrated success with difficult-to-express proteins like enterokinase catalytic subunit, achieving stable high-level expression of active protein .

How does KEX1 compare functionally with other prohormone-processing proteases across different species?

KEX1 belongs to the evolutionary conserved family of subtilisin-like serine proteases involved in prohormone and precursor protein processing across eukaryotes. Comparative analysis reveals both conserved mechanisms and species-specific adaptations:

Functional comparison with related proteases:

ProteaseSpeciesSubstrate SpecificityCellular LocalizationFunctional Role
KEX1K. lactisKR↓ dibasic sitesGolgi/secretory pathwayKiller toxin processing, sporulation
KEX2S. cerevisiaeKR↓, RR↓ dibasic sitesGolgi apparatusα-factor processing, protoxin activation
FurinMammalsR-X-K/R-R↓Trans-Golgi networkGrowth factor, hormone processing
PC1/3MammalsR-X-X-R↓, K/R-R↓Secretory granulesNeuropeptide, hormone processing
SPC3MammalsR-X-K/R-R↓ER/GolgiProprotein processing

The functional relationship between KEX1 and KEX2 has been experimentally demonstrated through cross-species complementation studies, where KEX1 can rescue kex2 mutations in S. cerevisiae and vice versa . This functional conservation extends beyond yeast to mammalian systems, where subtilisin-like proprotein convertases (SPCs) perform analogous roles in protein maturation.

Despite these similarities, KEX1 displays unique characteristics:

  • It shows greater substrate selectivity than some mammalian convertases

  • It has dual roles in both killer toxin processing and sporulation

  • It contains a distinctive transmembrane domain architecture

These comparative insights suggest KEX1 represents an evolutionarily intermediate form between ancestral bacterial subtilisins and specialized mammalian prohormone convertases.

What emerging research directions are expanding our understanding of KEX1 beyond its canonical protease functions?

Recent research is uncovering novel roles for KEX1 beyond its classical function as a processing protease, opening several promising research directions:

Role in cellular stress responses

Emerging evidence suggests KEX1 may participate in protein quality control during cellular stress, potentially through:

  • Selective processing of stress-responsive proteins

  • Clearance of misfolded secretory proteins

  • Activation of stress-protective factors

Involvement in cell wall biogenesis and remodeling

KEX1's localization in the secretory pathway positions it to influence cell wall composition through:

  • Processing of cell wall mannoproteins

  • Maturation of enzymes involved in β-glucan remodeling

  • Activation of cell wall integrity signaling components

Potential applications in synthetic biology

KEX1's site-specific proteolytic activity offers opportunities for:

  • Design of synthetic signaling circuits with proteolytic activation steps

  • Creation of self-cleaving protein modules for biotechnology

  • Engineering conditional protein expression systems

Systems biology integration

Understanding KEX1 in the context of broader cellular networks will require:

  • Proteome-wide identification of KEX1 substrates using degradomics approaches

  • Mapping the interplay between KEX1 and other proteases

  • Computational modeling of KEX1's influence on secretory pathway dynamics

Biotechnological innovations

The unique properties of KEX1 are being exploited for:

  • Development of expression systems for difficult-to-produce proteins

  • Creation of self-activating enzyme precursors

  • Design of protease-activated therapeutics

These emerging research directions highlight the importance of KEX1 as more than just a processing protease for killer toxin, suggesting broader significance in cellular homeostasis, development, and potential biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.