Recombinant Kluyveromyces lactis Protein ERD1 (ERD1)

Shipped with Ice Packs
In Stock

Description

Introduction

The ERD1 gene, initially identified in Saccharomyces cerevisiae, plays a crucial role in endoplasmic reticulum (ER) retention and the unfolded protein response (UPR) . The erd1 mutants were first isolated in a screen for mutants that secrete HDEL-invertase . While ERD2 has been characterized as the receptor that binds and retrieves ER proteins containing a C-terminal HDEL sequence, the function of Erd1 has remained uncharacterized for a long time . Recent studies have elucidated its function in Golgi glycosyltransferase recycling and its interactions with other proteins involved in protein trafficking . The UPR is a signaling pathway that eukaryotic cells use to adapt to harmful conditions that disrupt ER homeostasis .

Function and Mechanism of Action

  • Role in Glycosyltransferase Recycling Erd1 is essential for the recycling of early Golgi enzymes . It chaperones early Golgi glycosylation enzymes throughout their trafficking in the Golgi and facilitates stable interaction with the cytosolic receptor Vps74, which acts as a key component of the glycosyltransferase recycling pathway . Erd1 and Vps74 are required for recycling certain enzymes from late to early Golgi compartments via COPI vesicles .

  • Genetic Interactions and Functional Enrichment Genome-wide genetic interaction networks show that Erd1 is functionally related to genes mediating glycosylation and transport events at the ER and Golgi . Erd1 interacts with genes known to mediate glycosylation and transport events at the ER and Golgi .

  • Impact on Protein Localization In erd1 mutant cells, Golgi glycosyltransferases such as Och1 and Kre2 are mislocalized to the vacuole lumen, indicating a specific sorting defect rather than a general Golgi trafficking defect .

  • Dosage Suppressor Screen A dosage suppressor screen identified genes (Gyp1, Cog5, Cog7, Ypt7, Dcr2, Neo1, Ers1) that, when expressed at higher levels, can compensate for the loss of Erd1 function, further supporting Erd1's role in Golgi protein recycling .

ER Retention and Interaction with Erd2

ER retention of soluble proteins often involves their binding to Erd2, the HDEL receptor . Studies indicate an interaction between Erd2 and Erd1, suggesting they may assemble to restrict protein transport out of the ER . Erd1's role in ER retention may be mediated by its physical interaction with Erd2 .

ER Stress Response in Kluyveromyces lactis**

In Kluyveromyces lactis, the unfolded protein response (UPR) pathway is activated by ER stress . Kluyveromyces lactis IRE1 is involved in the UPR pathway . A Klire1 mutant is sensitive to ER stress induced by Tn or 2-DOG . The K. lactis KAR2 gene codes for the major ER chaperone, Kar2 .

Comparison with Saccharomyces cerevisiae**

The K. lactis HAC1 mRNA is regulated and activated similarly to that of S. cerevisiae . The cleavage motifs before and after exon–intron junctions are the same among K. marxianus, K. lactis and S. cerevisiae, suggesting that a conserved HAC1-splicing mechanism exists within Saccharomycetaceae .

Tables Summarizing Key Findings

FeatureDescription
Primary FunctionRecycling of early Golgi enzymes, chaperoning glycosylation enzymes
Interaction with Vps74Facilitates stable interaction with cytosolic receptor Vps74 for glycosyltransferase recycling
Localization in erd1 MutantsGolgi glycosyltransferases mislocalized to the vacuole lumen
Genetic InteractionsInteracts with genes involved in glycosylation and transport at the ER and Golgi
Role in ER RetentionMay interact with Erd2 to restrict protein transport out of the ER
Role in Ion HomeostasisProposed role in phosphate transport from the Golgi lumen to the cytosol
UPR PathwayInvolved in the unfolded protein response in Kluyveromyces lactis

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ERD1; KLLA0A02057g; Protein ERD1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-384
Protein Length
full length protein
Species
Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)
Target Names
ERD1
Target Protein Sequence
MDAESVEPFLVYLPIPQRVVVLVLLGLWLWTWFLKVSVSYYDVSKVIVSNESTGLPYFNT STKIHQSSLKLFKSISRVIIPWQLVCIILFQYSFTNNVSNKLLWFFLNVSPLLELFYIFA MILRSSAMVARCFKRILWVADIEPKPYRNNYIIISDTLTSYSKPLVDLAIYATFLFHDPT NVKCQVERYENAISLNIDVLVGVLPSLVRMIQSLREFTRGRSQKKDGSQLFNAFKYAGNI PIMLVTVYTRYYNLGPLGMMYWFMFWNSAYSFWWDVTMDWKLELFDFVNGDTSVNNNNSS NKADGLLRSILLYRKNAWYYSAMALDFILRFVWFWEYISGHSVFYGELNIFWLQILEIIR RWIWLFFKVEVEYIATTEGGKMDE
Uniprot No.

Target Background

Function
Essential for retaining luminal endoplasmic reticulum proteins and influences glycoprotein processing within the Golgi apparatus.
Database Links
Protein Families
ERD1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is K. lactis ERD1 and what is its primary function?

K. lactis ERD1 is a protein required for the correct localization of soluble proteins that normally reside in the endoplasmic reticulum (ER). The protein consists of 384 amino acids and functions as a key component in preventing inappropriate secretion of ER-resident proteins . Functionally, ERD1 helps maintain the integrity of the ER by ensuring resident proteins remain properly localized rather than being secreted. Cells lacking ERD1 exhibit defects in glycoprotein processing and inappropriately secrete resident ER proteins . This indicates that ERD1 plays a crucial role in ER protein retention mechanisms, potentially through direct or indirect interaction with components of the protein trafficking machinery.

What is the predicted structure of K. lactis ERD1?

Based on sequence analysis, K. lactis ERD1 appears to be a membrane protein with multiple transmembrane domains. The full amino acid sequence (MDAESVEPFLVYLPIPQRVVVLVLLGLWLWTWFLKVSVSYYDVSKVIVSNESTGLPYFNTSTKIHQSSLKLFKSISRVIIPWQLVCIILFQYSFTNNVSNKLLWFFLNVSPLLELFYIFAMILRSSAMVARCFKRILWVADIEPKPYRNNYIIISDTLTSYSKPLVDLAIYATFLFHDPTNVKCQVERYENAISLNIDVLVGVLPSLVRMIQSLREFTRGRSQKKDGSQLFNAFKYAGNIPIMLVTVYTRYYNLGPLGMMYWFMFWNSAYSFWWDVTMDWKLELFDFVNGDTSVNNNNSSNKADGLLRSILLYRKNAWYYSAMALDFILRFVWFWEYISGHSVFYGELNIFWLQILEIIRRWIWLFFKVEVEYIATTEGGKMDE) indicates the presence of hydrophobic regions consistent with membrane insertion . When conducting structural studies, researchers should consider these membrane-associated properties in their experimental design, particularly for protein solubilization and purification strategies.

How does deletion of ERD1 affect protein secretion in K. lactis?

Deletion of ERD1 in K. lactis leads to the inappropriate secretion of ER-resident proteins and causes defects in glycoprotein processing . To study this phenotype methodologically, researchers should:

  • Generate ERD1 deletion strains using homologous recombination techniques

  • Analyze the secretome using proteomics approaches to identify which ER-resident proteins are inappropriately secreted

  • Examine glycosylation patterns of secreted proteins using glycoprotein-specific staining methods or mass spectrometry

  • Compare the results with those from similar deletions in S. cerevisiae to identify conserved and divergent effects

These approaches can reveal the specific impact of ERD1 on protein trafficking pathways and may identify substrate specificities unique to K. lactis.

What is the relationship between ERD1 and the oxidative folding machinery?

The relationship between ERD1 and the oxidative folding machinery appears complex. While ERD1 itself is not directly part of the oxidative folding machinery, it likely influences this process through its role in ER protein retention. The oxidative folding machinery in K. lactis includes key proteins like Pdi1p and Ero1p, which are critical for the formation of disulfide bonds in secreted proteins .

Studies have shown that increased expression of components of the oxidative folding machinery can enhance the secretion of heterologous proteins with disulfide bonds in K. lactis . For example, duplication of either PDI1 or ERO1 led to an increase in human serum albumin (HSA) yield, and duplication of both genes accelerated HSA secretion and improved cell growth rate and yield . Interestingly, manipulating these pathways did not affect the production of human interleukin 1β, a protein without disulfide bridges .

To investigate potential relationships between ERD1 and the oxidative folding machinery, researchers should consider:

  • Creating double mutants lacking both ERD1 and components of the oxidative folding machinery

  • Examining how overexpression of ERD1 affects the expression and activity of Pdi1p and Ero1p

  • Analyzing how ERD1 deletion affects the secretion of proteins with varying numbers of disulfide bonds

How does ERD1 expression change under stress conditions?

To methodically investigate ERD1 expression under stress:

  • Expose K. lactis cultures to various stressors (ER stress inducers like tunicamycin or DTT, oxidative stress, hypoxia)

  • Measure ERD1 mRNA levels using RT-qPCR

  • Create an ERD1 promoter-reporter fusion to monitor expression changes in real-time

  • Compare ERD1 expression patterns with those of known stress-responsive genes

What is the impact of hypoxic conditions on ERD1 function?

While the specific impact of hypoxic conditions on ERD1 function is not directly addressed in the search results, K. lactis is known to grow in hypoxic conditions (oxygen availability below 1% of fully aerobic levels) even though it cannot grow under strictly anoxic conditions . Several genes in K. lactis are upregulated during hypoxia, including KlHEM13 and KlHEM1 from the heme biosynthetic pathway, and KlPDC1, which encodes pyruvate decarboxylase .

To investigate ERD1 function under hypoxic conditions, researchers could:

  • Compare ERD1 expression levels between normoxic and hypoxic conditions

  • Assess the ability of ERD1 knockout strains to grow under hypoxic conditions

  • Examine whether hypoxia affects the ERD1-dependent retention of ER resident proteins

  • Analyze whether ERD1 interacts with any hypoxia-responsive proteins

What expression systems are optimal for recombinant K. lactis ERD1 production?

Based on the search results, recombinant K. lactis ERD1 has been successfully expressed in E. coli with an N-terminal His tag . This approach allows for relatively straightforward purification using affinity chromatography.

For researchers planning to express recombinant K. lactis ERD1:

  • E. coli expression: Use a bacterial expression vector with an N-terminal His tag. Consider using strains optimized for membrane protein expression such as C41(DE3) or C43(DE3).

  • Yeast expression systems: For more native-like post-translational modifications, consider expressing ERD1 in S. cerevisiae using complementation of an erd1 deletion strain to confirm functionality .

  • Cell-free expression systems: For difficult-to-express membrane proteins like ERD1, cell-free systems may offer advantages by avoiding toxicity issues associated with membrane protein overexpression.

The choice of expression system should be guided by the intended application and required protein quality.

What purification strategies work best for recombinant K. lactis ERD1?

For purification of recombinant K. lactis ERD1, the following methodological approach is recommended:

  • Affinity chromatography: For His-tagged ERD1, use Ni-NTA or IMAC purification as the first step .

  • Detergent selection: As ERD1 is a predicted membrane protein, proper detergent selection is crucial. Screen mild detergents such as DDM, LMNG, or digitonin for protein extraction and stability.

  • Buffer optimization: Store purified ERD1 in Tris/PBS-based buffer with 6% trehalose at pH 8.0 to maintain stability .

  • Storage considerations: Avoid repeated freeze-thaw cycles. Store at -20°C/-80°C with 5-50% glycerol (optimal final concentration of 50%) .

  • Reconstitution: Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

This staged purification approach, combined with careful attention to protein stability conditions, should yield functional recombinant K. lactis ERD1 suitable for further studies.

How can functional assays be designed for K. lactis ERD1?

Designing functional assays for K. lactis ERD1 requires consideration of its role in ER protein retention. Some methodological approaches include:

  • Complementation assays: Test whether recombinant K. lactis ERD1 can restore normal ER protein retention in S. cerevisiae erd1 deletion strains .

  • Secretion analysis: Monitor the secretion of known ER resident proteins in the presence and absence of functional ERD1. This can be done using western blotting, enzyme activity assays, or proteomics approaches.

  • Glycoprotein processing: Assess glycoprotein processing defects using glycosidase sensitivity assays or glycoprotein staining methods.

  • Subcellular localization studies: Use fluorescently tagged ER resident proteins to track their localization in ERD1 wild-type versus knockout strains.

  • Protein-protein interaction studies: Identify ERD1 binding partners using techniques such as co-immunoprecipitation, yeast two-hybrid, or proximity labeling methods.

These functional assays should include appropriate controls, such as wild-type strains, empty vector controls, and known ER retention mutants.

What challenges might arise when working with recombinant K. lactis ERD1?

Several methodological challenges may arise when working with recombinant K. lactis ERD1:

  • Membrane protein expression issues: As a predicted membrane protein, ERD1 may show toxic effects when overexpressed, leading to low yields or inclusion body formation.

  • Protein stability concerns: Membrane proteins often exhibit stability issues outside their native membrane environment. Use appropriate detergents and stabilizing agents (such as trehalose) .

  • Functional validation: Confirming the activity of recombinant ERD1 may be challenging due to the complexity of ER retention mechanisms.

  • Structural analysis difficulties: Membrane proteins present unique challenges for structural studies. Consider using specialized techniques like cryo-EM or novel crystallization approaches.

To address these challenges, researchers should optimize expression conditions, use appropriate detergents for membrane protein solubilization, and consider fusion partners that may enhance solubility and stability.

How can the impact of ERD1 on specific ER resident proteins be assessed?

To methodically assess the impact of ERD1 on specific ER resident proteins:

  • Quantitative proteomics: Compare the secretome and ER proteome between wild-type and erd1 deletion strains using SILAC or TMT labeling for quantitative mass spectrometry.

  • Reporter protein systems: Create fusion proteins consisting of known ER resident proteins linked to easily detectable reporters (GFP, luciferase) to track their localization.

  • Glycosylation analysis: Examine changes in glycosylation patterns of specific ER proteins using glycosidase sensitivity assays or mass spectrometry.

  • Pulse-chase experiments: Assess the kinetics of protein retention and secretion using radioactive or non-radioactive pulse-chase methodologies.

  • Immunofluorescence microscopy: Visualize the subcellular localization of ER resident proteins in the presence and absence of ERD1.

lactis ERD1 Protein Properties

PropertyValueReference
UniProt IDP41771
Protein Length384 amino acids
Molecular Weight~43 kDa (estimated)Calculated from sequence
Expression SystemE. coli
TagN-terminal His tag
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Recommended Reconstitution0.1-1.0 mg/mL in deionized sterile water
Glycerol for Storage5-50% (optimal: 50%)
Homology to S. cerevisiae ERD1~30% identity, ~50% similarity

Comparative Analysis of K. lactis as an Expression Host

FeatureK. lactisS. cerevisiaeReference
Growth under anoxic conditionsUnable to growCan grow
Growth under hypoxic conditionsCan grow (below 1% O₂)Can grow
Glycosylation of recombinant proteinsYesYes
Secretion of human IL-1βHigh levels with signal sequenceYes
Effect of glycosylation on IL-1β activity95% loss of biological activitySimilar loss
Response to ERO1 overexpressionNo DTT resistance conferredResistance to DTT
ERO1 induction by DTTStrong inductionYes
ERO1 induction by HSA expressionModerate inductionNot specified

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.