Recombinant Kluyveromyces lactis Rhomboid protein 2 (RBD2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please include it in your order notes, and we will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
RBD2; KLLA0D12804g; Rhomboid protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-271
Protein Length
full length protein
Species
Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)
Target Names
RBD2
Target Protein Sequence
MNIKQFFVPAGKPLSGLAVGLSIFLTALFLVNNLVYPINEHLLLKPDSLFKFDLNRISLY PLAHLSFFHLFFNVISTFSMIVMFEESHGTLYTGVILNLLAVFTAIPYCLIGSLLFPNVE IGGASGWFFSFLGYFAVKESRVRNSVMITSTFSFPTLYFPVALLFVTALLAPGSSLPGHA IGLLLGYFMGLKENWVAKITPPSFVLKKIETWVDPLINLIPFGIKYYREVEVDRSLEYTS VYLGSESRLPLHNTDTPAEPTFQGNGRVLGN
Uniprot No.

Target Background

Function
This protein is likely a serine protease.
Database Links
Protein Families
Peptidase S54 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein. Golgi apparatus, cis-Golgi network membrane; Multi-pass membrane protein.

Q&A

What are the key differences between Kluyveromyces lactis and Saccharomyces cerevisiae as expression systems for recombinant proteins?

K. lactis and S. cerevisiae exhibit fundamental differences in their metabolic preferences that impact recombinant protein expression. K. lactis demonstrates a predominantly respiratory metabolism with higher glucose flow through the pentose phosphate pathway (PPP) than through glycolysis, resulting in greater cytosolic NADPH production compared to S. cerevisiae . This metabolic preference makes K. lactis particularly advantageous for expressing proteins requiring extensive disulfide bond formation or post-translational modifications.

Additionally, K. lactis lacks the Crabtree effect (inhibition of respiration by fermentation) characteristic of S. cerevisiae, with the key difference lying in the mechanisms for NADPH reoxidation . In K. lactis, mitochondrial external alternative dehydrogenases (NDEs) play a significant role in NADPH reoxidation, while S. cerevisiae enzymes cannot utilize this cofactor effectively . These metabolic distinctions contribute to K. lactis offering potentially higher yields and different folding environments for certain recombinant proteins, including membrane-associated proteins like RBD2.

What molecular characteristics define Rhomboid protein 2 in K. lactis?

Rhomboid protein 2 (RBD2) in K. lactis belongs to the evolutionary conserved family of intramembrane serine proteases that cleave transmembrane segments of substrate proteins within the lipid bilayer. The protein contains multiple transmembrane domains with a catalytic dyad consisting of serine and histidine residues. While RBD2 shares core structural elements with other rhomboid proteases, the K. lactis variant exhibits distinct regulatory patterns compared to its S. cerevisiae homolog, particularly in its response to hypoxic conditions .

Unlike many S. cerevisiae hypoxic genes, the transcriptional regulation of RBD2 in K. lactis appears to follow alternative regulatory mechanisms not governed by the typical Hap1p/Rox1p circuit. This is consistent with broader observations that the hypoxic transcriptional response in K. lactis differs notably from S. cerevisiae, with unique sets of upregulated genes in hypoxic conditions .

What expression vectors are most suitable for recombinant K. lactis RBD2 production?

For successful expression of recombinant K. lactis RBD2, researchers should consider vectors containing:

  • Strong inducible promoters compatible with K. lactis metabolism, such as those derived from LAC4 (β-galactosidase) or GAL1 genes, which allow tight regulation of protein expression

  • Selection markers appropriate for K. lactis, including acetamide selection (amdS) or antibiotic resistance genes optimized for this yeast

  • Secretion signal sequences if extracellular production is desired, with the native K. lactis α-mating factor signal sequence often providing better secretion efficiency than heterologous signals

  • Appropriate fusion tags that accommodate the membrane protein nature of RBD2 while facilitating purification

The vector choice should be guided by the specific experimental goals, with consideration of whether the native protein characteristics need to be preserved or if fusion constructs are acceptable for the intended analyses.

How can researchers optimize culture conditions to enhance functional expression of recombinant K. lactis RBD2?

Optimizing the functional expression of recombinant K. lactis RBD2 requires careful consideration of multiple parameters given its nature as a membrane protein and the respiratory preference of K. lactis. The following methodological approach is recommended:

Table 1: Optimization Parameters for K. lactis RBD2 Expression

ParameterRecommended ConditionsRationale
Temperature25-28°CLower temperatures slow protein synthesis, allowing proper membrane insertion
Carbon Source2% glucose for initial growth; 0.5-2% lactose or galactose for inductionSupports respiratory metabolism while enabling controlled induction
Oxygen Availability30-60% dissolved oxygenBalances respiratory needs while avoiding oxidative stress
Media Supplements0.1-1.0 mM ergosterol; 5-10 μM hemeProvides essential components for membrane biogenesis and oxygen sensing
pH6.0-6.5Optimizes cell growth while maintaining protein stability
Induction TimingMid-log phase (OD600 ~5-10)Ensures robust cellular machinery for protein production

The unique redox metabolism of K. lactis makes oxygen availability particularly critical. Unlike S. cerevisiae, K. lactis has a predominantly respiratory metabolism with higher glucose flow through the PPP than through glycolysis . Therefore, maintaining appropriate oxygen levels without inducing oxidative stress is essential. The balance between respiration and fermentation can be modulated by adjusting glucose concentration and aeration rates.

What purification strategies are most effective for obtaining high-quality recombinant K. lactis RBD2?

Purifying RBD2 presents challenges common to membrane proteins while incorporating considerations specific to K. lactis expression systems. A systematic purification approach includes:

  • Optimal cell disruption: Mechanical disruption (e.g., high-pressure homogenization) at 4°C in buffer containing 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 1 mM EDTA, and protease inhibitors.

  • Membrane fraction isolation: Differential centrifugation with an initial low-speed step (3,000 × g, 10 min) to remove cell debris, followed by ultracentrifugation (100,000 × g, 1 hour) to collect membrane fractions.

  • Detergent screening: Systematic evaluation of detergents for solubilization efficiency and retention of protein activity. For rhomboid proteases, mild detergents like DDM (n-dodecyl-β-D-maltoside) at 1% (w/v) or LMNG (lauryl maltose neopentyl glycol) at 0.5-1% (w/v) typically provide good results.

  • Purification sequence:

    • Affinity chromatography using engineered tags (His6, FLAG, etc.)

    • Size exclusion chromatography to remove aggregates and detergent micelles

    • Optional ion exchange chromatography for higher purity

  • Quality assessment: Size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to verify monodispersity and appropriate oligomeric state.

Importantly, the distinct redox environment of K. lactis compared to S. cerevisiae can affect disulfide bond formation in the recombinant protein . This necessitates careful attention to reducing agent concentration during purification, potentially using a gradient of reducing conditions to identify optimal redox states for RBD2 stability and activity.

How can researchers assess the enzymatic activity of purified K. lactis RBD2?

Rhomboid proteases like RBD2 require specialized assays to accurately measure their intramembrane proteolytic activity. A comprehensive activity assessment includes:

  • Fluorogenic peptide substrates: Peptides spanning recognized cleavage sites conjugated with fluorophore/quencher pairs that increase fluorescence upon cleavage. These should be incorporated into liposomes or detergent micelles to mimic the membrane environment.

  • Reconstitution into proteoliposomes: Incorporating purified RBD2 into liposomes of defined composition allows assessment of lipid dependency and provides a native-like environment for activity measurements.

  • Mass spectrometry-based assays: Incubation of RBD2 with potential substrate proteins followed by LC-MS/MS analysis to identify specific cleavage sites.

  • In vitro transcription/translation systems: Cell-free expression systems supplemented with microsomes enable evaluation of co-translational RBD2 activity.

When designing activity assays, researchers should consider the unique metabolic background of K. lactis. The higher cytosolic NADPH production through the PPP pathway may influence the native redox environment around RBD2, potentially affecting its catalytic properties. This effect can be assessed by comparing activity under varying redox conditions.

How should researchers analyze K. lactis RBD2 expression data to account for the yeast's unique metabolism?

Analyzing expression data for K. lactis RBD2 requires consideration of the distinct metabolic background of this yeast. Researchers should:

What are the key considerations when comparing RBD2 functional data between K. lactis and S. cerevisiae expression systems?

When comparing functional data for RBD2 expressed in K. lactis versus S. cerevisiae, researchers must account for several fundamental differences between these systems:

Table 2: Key Differences Affecting Comparative Analysis of K. lactis and S. cerevisiae RBD2 Expression

ParameterK. lactisS. cerevisiaeImpact on RBD2 Analysis
Metabolic PreferenceRespiratoryFermentativeDifferent membrane composition affecting RBD2 activity environment
NADPH ProductionHigher PPP fluxLower PPP fluxAltered cellular redox environment influencing disulfide bonds
Hypoxic ResponseUnique gene setWell-characterized regulonsDifferent transcriptional control of membrane-associated proteins
Transcriptional RegulationKlHAP1 does not activate respiration genesHap1p controls respirationAlternative expression patterns under varying oxygen conditions
Ergosterol BiosynthesisConserved pathway, different regulationWell-characterized SRE-mediated regulationPotential differences in membrane sterol content

A robust comparative analysis should normalize for these system differences by:

  • Standardizing membrane composition through liposome reconstitution experiments

  • Performing activity assays under controlled redox environments

  • Utilizing common substrate proteins expressed in neutral systems

  • Developing correction factors based on quantitative proteomics of membrane fractions

Importantly, the transcriptional regulators controlling hypoxic response differ significantly between the two yeasts. While the sterol biosynthetic pathway genes are conserved, their regulation appears to follow different patterns . This may result in different membrane sterol content when expressing RBD2 under identical oxygen conditions, potentially affecting protein function and requiring analytical compensation.

How can researchers distinguish between RBD2 function and artifacts introduced by the K. lactis expression system?

Distinguishing genuine RBD2 functions from expression system artifacts requires implementation of multiple controls and validation approaches:

  • Expression system controls:

    • Empty vector controls processed identically to RBD2-expressing strains

    • Expression of catalytically inactive RBD2 mutants (e.g., serine catalytic residue mutation)

    • Comparison with alternative expression systems (e.g., E. coli, mammalian cells)

  • Activity validation approaches:

    • in vitro reconstitution with defined components to eliminate cellular background

    • Substrate validation across multiple systems

    • Correlation of activity with properly folded protein quantification

  • Controls for K. lactis-specific effects:

    • Monitoring GLR activity, which in K. lactis has a regulatory role upon the fermentation/respiration balance

    • Assessing the potential influence of NDEs, as K. lactis NDEs can use NADPH, while S. cerevisiae enzymes cannot

    • Evaluating potential THX-TRR system influence, as this system can replace GLR in maintaining GSH/GSSG ratio in K. lactis

  • Structural validation:

    • Circular dichroism spectroscopy to confirm secondary structure

    • Limited proteolysis to assess proper folding

    • Thermal shift assays to evaluate protein stability

When analyzing RBD2 function, researchers should be particularly attentive to the different response to oxidative stress between K. lactis and S. cerevisiae. While GLR expression increases in response to oxidative stress in S. cerevisiae through a Yap1-mediated mechanism, this effect is absent in K. lactis . This differential response can affect the cellular environment of RBD2 and potentially its activity profile.

What strategies can resolve low expression yields of recombinant K. lactis RBD2?

Low expression yields of recombinant K. lactis RBD2 can be addressed through systematic troubleshooting:

Table 3: Troubleshooting Strategies for Low K. lactis RBD2 Expression

IssuePotential CauseSolution Strategy
Poor transcriptionSuboptimal promoter choiceTest alternative promoters (e.g., LAC4, GAL1, PGK)
Inefficient transcription factorsSupplement media with heme (5-10 μM) to enhance activity of heme-dependent transcription factors
Oxygen-dependent repressionAdjust aeration rates; monitor dissolved oxygen levels
Translation inefficiencyCodon biasOptimize codons for K. lactis preference; avoid rare codons
Secondary structure in mRNAModify 5' UTR sequence to minimize strong secondary structures
Protein degradationProtease activitySupplement media with casamino acids (0.5%); use protease-deficient strains
Improper folding triggering degradationLower expression temperature to 20-25°C; include chemical chaperones
Toxicity of RBD2Membrane disruptionUse tightly controlled inducible promoters; reduce induction strength
Cleavage of essential host proteinsExpress catalytically inactive mutant for biomass generation, then induce wild-type

For K. lactis-specific considerations, researchers should note that the transcriptional regulation of genes in this yeast differs from S. cerevisiae. For example, while in S. cerevisiae the expression of certain genes is controlled by Hap1p, in K. lactis the function of KlHAP1 does not affect growth in fermentative or respiratory media . Also noteworthy is that KlROX1 does not regulate the hypoxic response in K. lactis , necessitating alternative strategies for oxygen-dependent expression control.

Supplementing growth media with ergosterol may also enhance RBD2 expression, as membrane protein integration can be limited by sterol availability. This is particularly relevant given the differences in sterol regulatory circuits between K. lactis and S. cerevisiae .

How can researchers address issues with RBD2 mislocalization in K. lactis?

RBD2 mislocalization can significantly impact protein function and yield. Addressing this issue requires:

  • Accurate localization assessment using:

    • Fluorescent protein fusions with confocal microscopy

    • Subcellular fractionation followed by Western blotting

    • Protease protection assays to determine topology

  • Optimization strategies for proper membrane targeting:

    • Ensure native signal sequences are intact or replaced with validated K. lactis-specific signals

    • Modify hydrophobic regions to match K. lactis membrane preferences

    • Include known K. lactis membrane protein targeting motifs

    • Express with compatible chaperones to assist membrane integration

  • K. lactis-specific considerations:

    • Account for different membrane composition due to respiratory preference

    • Consider the impact of the unique redox environment of K. lactis on disulfide bond formation in the secretory pathway

    • Modify growth conditions to influence membrane fluidity, particularly oxygen levels which affect ergosterol biosynthesis

The distinct hypoxic response in K. lactis compared to S. cerevisiae may influence membrane composition under different oxygen conditions . While both yeasts contain homologous genes for sterol biosynthesis, their regulation follows different patterns . Researchers should therefore carefully monitor oxygen levels during expression and consider supplementing cultures with defined lipid mixtures to standardize membrane environments.

What techniques can resolve activity inconsistencies when working with recombinant K. lactis RBD2?

Activity inconsistencies with recombinant K. lactis RBD2 can be methodically addressed through:

  • Standardization of enzyme preparations:

    • Quantify active site concentration using titration with irreversible inhibitors

    • Implement rigorous quality control to ensure consistent protein conformational states

    • Verify oligomeric state using SEC-MALS before activity measurements

  • Optimization of assay conditions:

    • Systematically vary detergent type and concentration to identify optimal micelle properties

    • Test different lipid compositions when using liposome reconstitution

    • Establish detailed pH and ionic strength profiles for activity

    • Control redox environment precisely, particularly important given the unique redox metabolism of K. lactis

  • K. lactis-specific considerations:

    • Account for potential modifications introduced by the K. lactis secretory pathway

    • Evaluate the impact of different membrane composition on RBD2 activity

    • Consider the influence of K. lactis-specific post-translational modifications

  • Advanced analytical approaches:

    • Implement single-molecule enzymology to identify heterogeneous populations

    • Utilize hydrogen-deuterium exchange mass spectrometry to correlate structural dynamics with activity

    • Apply computational modeling to understand system-specific influences on catalysis

When troubleshooting activity inconsistencies, researchers should consider that the different redox metabolism in K. lactis compared to S. cerevisiae might affect protein folding and stability. The thioredoxin-TRR system in K. lactis can reduce GSSG and potentially replace GLR in maintaining the GSH/GSSG ratio , which could influence the stability of disulfide bonds in the recombinant protein.

How can researchers leverage K. lactis-specific pathways to enhance RBD2 functional studies?

Researchers can exploit K. lactis-specific pathways to enhance RBD2 functional studies through several innovative approaches:

  • Utilizing the respiratory preference of K. lactis to study RBD2 function under physiologically relevant oxygen conditions. Unlike S. cerevisiae, K. lactis does not suppress respiration in the presence of glucose , making it valuable for studying oxygen-dependent regulation of rhomboid proteases.

  • Exploiting the unique NADPH metabolism of K. lactis for investigating redox-dependent RBD2 activity. The higher glucose flow through the PPP than through glycolysis in K. lactis creates a distinct redox environment that may reveal novel aspects of RBD2 regulation not observable in other systems.

  • Leveraging the differential hypoxic response for studying membrane protein dynamics. The hypoxic transcriptional response in K. lactis differs notably from S. cerevisiae , potentially providing insights into alternative regulatory mechanisms affecting membrane protein function.

  • Developing K. lactis-specific genetic tools that take advantage of its unique biology:

    • CRISPR-Cas9 systems optimized for K. lactis genome editing

    • Synthetic biology parts that respond to K. lactis-specific transcription factors

    • Reporter systems that interface with K. lactis metabolic pathways

  • Creating chimeric regulatory systems that combine the strengths of both K. lactis and S. cerevisiae to achieve precise control over RBD2 expression and activity.

These approaches can reveal new insights into RBD2 function by placing it in a cellular context that differs significantly from conventional model systems, potentially uncovering regulatory mechanisms and protein-protein interactions that are not evident in other expression systems.

What comparative genomic approaches can enhance understanding of K. lactis RBD2 structure-function relationships?

Comparative genomic approaches provide powerful tools for elucidating RBD2 structure-function relationships in K. lactis:

These approaches can leverage the evolutionary distance between K. lactis and other yeasts to isolate conserved functional elements of RBD2 from species-specific adaptations, providing deeper insights into fundamental mechanisms of intramembrane proteolysis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.