Recombinant Kluyveromyces lactis Solute carrier family 25 member 38 homolog (KLLA0E08911g)

What is the Solute carrier family 25 member 38 homolog (KLLA0E08911g) and what makes K. lactis suitable for its expression?

Solute carrier family 25 member 38 homolog (KLLA0E08911g) is a transmembrane protein involved in molecular transport processes across cellular membranes. The full protein consists of 294 amino acids with characteristic transmembrane domains typical of the SLC25 family . K. lactis has become a preferred expression system for this protein due to its food-grade safety status, robust growth characteristics, and ability to perform post-translational modifications similar to higher eukaryotes . Unlike some other yeast expression systems, K. lactis doesn't hyperglycosylate proteins and can secrete recombinant proteins efficiently into the culture medium, facilitating downstream purification processes.

The expression methodology typically involves:

• Gene cloning into specialized K. lactis expression vectors (like pKLAC1)

• Transformation into host strains (commonly GG799)

• Selection of positive transformants

• Induction of expression (often using galactose as inducer)

How can researchers design efficient expression constructs for KLLA0E08911g?

When designing expression constructs for KLLA0E08911g, researchers should consider:

• Promoter selection: The LAC4 promoter (inducible by galactose) is commonly used for controlled expression in K. lactis systems.

• Sequence optimization: Codon optimization based on K. lactis preferred codons can significantly improve expression levels.

• Signal sequence addition: For secreted expression, the α-mating factor signal sequence (α-MF) from Saccharomyces cerevisiae works effectively in K. lactis.

• Fusion tags: Consider adding tags like GST to enhance solubility of the expressed protein. GST tags have been shown to increase the solubility of proteins that tend to aggregate .

For KLLA0E08911g specifically, a construct design similar to that used for manganese peroxidases in K. lactis can be adapted, where genes are inserted at restriction sites like BglII and SalI in the pKLAC1 vector .

What are the most efficient methods for targeted integration of KLLA0E08911g expression cassettes?

The efficiency of targeted integration in K. lactis varies significantly based on the strategy employed:

For highest efficiency gene targeting when working with KLLA0E08911g, researchers should consider using K. lactis strains with NHEJ (non-homologous end joining) pathway disruptions, particularly Klku80 deletion mutants . In these strains, homologous recombination becomes the predominant integration mechanism, resulting in targeting efficiencies exceeding 97% regardless of the length of homologous flanking sequences .

If working with wild-type strains, increasing the length of homologous flanking sequences up to 600bp can improve targeting efficiency from 0% (with 50bp flanks) to 88% . Alternatively, transformation in the presence of excess small DNA fragments can enhance targeted integration even with PCR-generated constructs containing only 50bp homologous sequences .

How do homologous recombination (HR) and non-homologous end joining (NHEJ) pathways affect KLLA0E08911g integration?

The balance between HR and NHEJ pathways significantly impacts the integration outcomes for KLLA0E08911g expression cassettes:

• Homologous recombination (HR): Initiated by Rad52p binding to DNA ends, resulting in targeted integration at homologous loci. Depends on KlRAD51 and KlRAD52 genes .

• Non-homologous end joining (NHEJ): Mediated by the Ku heterodimer (Ku70p/Ku80p), leading to random integration throughout the genome .

In wild-type K. lactis, NHEJ often competes with HR, resulting in variable and generally low gene targeting efficiency. Research has demonstrated that deletion of KlKU80 effectively eliminates the NHEJ pathway, forcing double-strand break repair to proceed via homologous recombination, thereby dramatically improving targeting efficiency .

For researchers working with KLLA0E08911g, selecting between these approaches depends on the experimental goals:

• For precise modification or tagging of the endogenous gene: HR-based methods are essential

• For random integration of expression cassettes: NHEJ can be utilized

• For consistent, reliable targeted integration: KlKU80 deletion strains are recommended

What are the optimal conditions for inducing KLLA0E08911g expression in recombinant K. lactis strains?

Based on established protocols for recombinant protein expression in K. lactis, the following parameters should be optimized for KLLA0E08911g expression:

• Growth phase for induction: Initiate induction when cultures reach OD600 of approximately 1.0

• Induction medium: YEPG (Yeast Extract Peptone Galactose) medium for galactose-inducible promoters

• Temperature: Typically 28-30°C for K. lactis growth and protein expression

• Induction duration: 40-72 hours, depending on the specific construct and strain

• Medium supplements: Consider adding hemin and MnSO4 if the recombinant protein requires metal cofactors

For systematic optimization, researchers should employ orthogonal experimental design testing multiple factors including temperature, rotation speed, initial pH, galactose concentration, and cofactor concentrations . This approach allows for identifying optimal conditions with fewer experimental runs compared to changing one factor at a time.

What purification strategies are most effective for recombinant KLLA0E08911g?

For purification of recombinant KLLA0E08911g:

• Initial processing: Centrifugation to separate cells from culture supernatant (if protein is secreted)

• Concentration: 10-kDa ultrafiltration is effective for initial concentration

• Chromatographic methods:

  • Affinity chromatography if the construct includes affinity tags

  • Ion exchange chromatography based on the protein's theoretical pI

  • Size exclusion chromatography for final polishing

Researchers should note that recombinant KLLA0E08911g is typically stored in Tris-based buffer with 50% glycerol for stability . The storage recommendations include:

• Short-term storage: 4°C for up to one week

• Extended storage: -20°C or -80°C

• Avoiding repeated freeze-thaw cycles to maintain protein activity

What experimental approaches are recommended for studying KLLA0E08911g interactions with other proteins?

As a member of the solute carrier family, KLLA0E08911g likely functions within a network of protein-protein interactions. Several methodologies are particularly suitable for investigating these interactions:

• Co-immunoprecipitation (Co-IP): Particularly effective when using tagged versions of KLLA0E08911g

• Yeast two-hybrid (Y2H): Can be modified for membrane proteins using split-ubiquitin systems

• Bioluminescence resonance energy transfer (BRET): Useful for detecting interactions in living cells

• Proximity-dependent biotin identification (BioID): Effective for identifying interactions in native cellular contexts

When designing such experiments, researchers should consider using GST-tagged versions of KLLA0E08911g, which have been successfully employed for related proteins . The complete amino acid sequence of KLLA0E08911g (MSEQRRATTHLIGGFSGGLVSAIILQPFDLLKTRLQQDKTSTLWKTLKSIETPSQLWRGALPSCIRTSVGSAMYLTLNSI RQAISKGKNTGSTGSSYLPQLNMYENMFSGAVTRALTGLITMPITVIKVRYESTLYQYTSLR YATSHIFRTEG LRGFFRGFGATALRDAPYAGLYMLFYDRMKVLVPTLLPSNVVKLNSDNRYSTYAST LINGSSAFSAAVIATSI TAPFDTVKTRMQLEPAKFHSFTSTFWHIATKESVRNLFAGISLRLTRKAFSAGIAWGIYE EIVKKFV) can serve as a reference for designing experimental constructs .

How can researchers effectively analyze the subcellular localization of KLLA0E08911g?

As a putative membrane transport protein, determining the precise subcellular localization of KLLA0E08911g is crucial for understanding its function. Recommended approaches include:

• Fluorescent protein tagging: C- or N-terminal GFP fusions can be created through homologous recombination strategies in K. lactis

• Immunofluorescence microscopy: Using antibodies against the native protein or epitope tags

• Subcellular fractionation: Followed by western blotting to detect the protein in specific cellular compartments

• Electron microscopy with immunogold labeling: For high-resolution localization studies

When designing localization experiments, researchers should consider potential functional disruption caused by tags. Based on the protein sequence analysis, the transmembrane regions should be preserved when creating fusion constructs .

How can researchers address low expression levels of KLLA0E08911g in K. lactis?

When confronting low expression levels, several strategies have proven effective:

• Optimize codon usage: Adapt the coding sequence to K. lactis preferred codons

• Modify signal peptides: Test alternative secretion signals if the protein is poorly secreted

• Adjust cultivation conditions: Systematically optimize parameters through orthogonal experimental design

• Address protein misfolding: Consider co-expression with chaperones

• Modify expression vectors: Test different promoters or integration sites

For KLLA0E08911g specifically, the addition of a GST tag at the N-terminus might enhance solubility and expression levels, similar to strategies employed for manganese peroxidases in K. lactis .

What are the common challenges in gene targeting for KLLA0E08911g modification and how can they be overcome?

The most effective approach for overcoming gene targeting challenges is using K. lactis strains with disrupted NHEJ pathways. Research has demonstrated that deletion of the KlKU80 gene dramatically improves homologous recombination efficiency, making it possible to achieve targeted integration rates exceeding 97% even with short homology regions .