Recombinant Kluyveromyces lactis Spore membrane assembly protein 2 (SMA2)

Shipped with Ice Packs
In Stock

Description

Role in Spore Membrane Assembly

SMA2 is essential for prospore membrane morphogenesis during meiosis. Key functional insights include:

Mechanistic contributions:

  • Collaborates with septin proteins to regulate membrane curvature and closure during spore encapsulation

  • Localizes to the prospore membrane's leading edge, analogous to S. cerevisiae SMA1, suggesting evolutionary conservation in membrane organization

  • Interacts with the Leading Edge Protein (LEP) complex, which maintains membrane architecture by counteracting forces promoting curvature

Phenotypic effects of deletion:

  • In S. cerevisiae, sma2 mutants exhibit defective prospore membrane closure and irregular spore morphology

  • Synthetic lethality observed when sma2 is deleted alongside other LEP components (e.g., ady3)

Recombinant Production and Purification

Expression system:

  • Host: Kluyveromyces lactis (strain ATCC 8585)

  • Vector: Integrative plasmid pKLAC2 with α-mating factor secretion signal for efficient secretion

  • Selection: Acetamide utilization (amdS marker) for antibiotic-free selection of multi-copy integrants

Purification protocol:

  • Tag: Epitope tag (undisclosed type) added during production

  • Storage buffer: Tris-based with 50% glycerol at -20°C or -80°C

  • Yield: Commercial batches available at 50 µg quantities, scalable to larger volumes

Applications in Research

Current uses:

  • Structural studies: NMR and crystallography to resolve membrane protein dynamics

  • Functional genomics: Investigating sporulation defects in yeast mutants

  • Biotechnological tool: Studying secretory pathway efficiency in K. lactis expression systems

Emerging applications:

  • Chimeric protein engineering for synthetic membrane compartments

  • High-throughput screening of antifungal agents targeting spore formation

Table 1: Comparative Localization of Spore Membrane Proteins in Saccharomyces cerevisiae

Protein TypeLocalizationExample Genes
Integral membraneProspore membraneSMA2, YFL040w
Peripheral membraneProspore membraneMSO1, VPS13
SecretedSpore wallSGA1, CDA1

Challenges and Future Directions

  • Low solubility: SMA2’s hydrophobic domains complicate in vitro studies, necessitating detergent-based purification

  • Functional redundancy: Overlapping roles with SMA1 in K. lactis require dual-knockout studies for precise characterization

  • Industrial scaling: Optimizing secretion yields in K. lactis using autoinduction promoters like P<sub>350</sub>

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you require a specific format, please indicate your preference in the order remarks. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipment is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by several factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
SMA2; KLLA0B04972g; Spore membrane assembly protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-378
Protein Length
full length protein
Species
Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)
Target Names
SMA2
Target Protein Sequence
MRFKYISFIILISFSLLVWFSHLSNFTCTSSANLPICMPQYVFHFKDDTPTSKVLFSTVK EFFSLLSFFTLDFNWGIDLSELQDRYNQSNLINIFHPSNTYYVNAFGYCKHQAQDEKLNH YCIDNTNGLNIISVLIRDLGFQFGVLSETNVKITGDSFWIIYQTLINSFNKFLEDDKRGN TLLKMITPNDPNEMEQWKTRLWLINIYDAVNVVLKWTVVANCILASLCLMLLLFWMWMQI EHKKTQSPIKQLNWNINSICSITRCLSICNATITFIYILHILLLTFMINCFRYKRLQIIH ASLGTGAWFHIARFFVELIFAVLCFKWMTPHSAMSASVMSETQSTAVEDEEEKDTEDNYS ALNPASGTTAVDGFLLTV
Uniprot No.

Target Background

Function
This protein is involved in spore and ascus formation. It is essential for the efficient assembly of prospore membrane precursors into a continuous prospore membrane.
Database Links
Protein Families
SMA2 family
Subcellular Location
Prospore membrane; Multi-pass membrane protein.

Q&A

What is Kluyveromyces lactis Spore Membrane Assembly Protein 2 (SMA2) and what is its cellular function?

Kluyveromyces lactis Spore Membrane Assembly Protein 2 (SMA2) is a 378-amino acid protein encoded by the SMA2 gene (KLLA0B04972g) in K. lactis yeast. The protein plays a crucial role in the assembly of spore membranes during the process of sporulation. SMA2 is characterized by its transmembrane domains and appears to function in the organization of membrane components specifically required for spore formation. Functionally, it facilitates the proper assembly of the prospore membrane, which eventually surrounds the haploid nuclei during sporulation. This protein represents a specialized component of the yeast reproductive cycle, essential for producing viable spores under nutrient-limiting conditions .

What are the optimal storage conditions for recombinant SMA2 protein?

For optimal stability and activity retention of recombinant SMA2 protein:

Storage ParameterRecommended ConditionNotes
Short-term storage4°C for up to one weekAliquot to avoid repeated freeze-thaw
Long-term storage-20°C or -80°C-80°C preferred for extended periods
Storage bufferTris-based buffer, pH 8.0 with 50% glycerolBuffer optimized for protein stability
Recommended aliquot size10-50 μLMinimizes freeze-thaw cycles
Freeze-thaw toleranceAvoid more than 3 cyclesSignificant activity loss occurs beyond this

After reconstitution from lyophilized form, the protein should be stored in buffer containing 5-50% glycerol (with 50% being optimal for longest stability). Repeated freezing and thawing should be strictly avoided as it significantly reduces protein activity and structural integrity .

What expression systems are commonly used for recombinant SMA2 production?

While SMA2 is natively expressed in Kluyveromyces lactis, recombinant production typically employs heterologous expression systems:

Expression SystemAdvantagesLimitationsTag Options
E. coliHigh yield, cost-effective, rapid productionPotential issues with membrane protein foldingHis, GST, MBP
Yeast systems (S. cerevisiae)Native-like post-translational modificationsLower yield than bacterial systemsHis, FLAG
Insect cellsSuperior for complex membrane proteinsHigher cost, longer production timeHis, Strep
Mammalian cellsBest for complex folding requirementsHighest cost, lowest yieldHis, Fc

E. coli-based expression is frequently used for research applications, as evidenced by commercial recombinant SMA2 proteins. For example, the recombinant SMA2 protein described in the search results is produced in E. coli with an N-terminal His tag for purification purposes. This system balances yield with cost-effectiveness for research applications, though careful optimization of induction conditions is required to maximize proper folding of this membrane protein .

How can I validate the functional activity of recombinant SMA2 protein in experimental settings?

Validating functional activity of recombinant SMA2 requires multiple complementary approaches:

  • Structural integrity assessment:

    • Circular dichroism spectroscopy to confirm secondary structure elements

    • Size-exclusion chromatography to assess oligomeric state

    • Thermal shift assays to evaluate protein stability

  • Biochemical activity validation:

    • Lipid binding assays using fluorescence spectroscopy

    • Membrane integration assays with artificial liposomes

    • Co-immunoprecipitation with known binding partners

  • Functional complementation assays:

    • Transformation of SMA2-deletion yeast strains with the recombinant protein

    • Quantification of sporulation efficiency restoration

    • Microscopic analysis of spore membrane formation

  • In vitro reconstitution:

    • Reconstitution into proteoliposomes

    • Measurement of membrane curvature induction

    • Analysis of lipid organization changes

A comprehensive validation would include both in vitro biochemical assays and in vivo complementation studies. For example, researchers could compare sporulation rates between wild-type yeast, SMA2-knockout strains, and knockout strains complemented with the recombinant protein. Membrane localization can be confirmed using fluorescently-tagged versions of the protein during sporulation .

What are the challenges in purifying functional recombinant SMA2 and how can they be addressed?

Purifying functional SMA2 presents several challenges due to its membrane protein nature:

ChallengeManifestationMitigation Strategy
Poor solubilityAggregation during extractionUse specialized detergents (DDM, LMNG, or CHAPS)
MisfoldingLoss of functional conformationExpress at lower temperatures (16-18°C)
Low yieldInsufficient protein for experimentsOptimize codon usage for expression host
Detergent interferenceDetergents affecting downstream assaysDetergent screening; use amphipols for detergent removal
Stability issuesProtein degradation during purificationInclude protease inhibitors throughout purification
Tag interferenceExpression tags affecting functionUse cleavable tags; validate function post-cleavage

Recommended purification protocol:

  • Solubilize membrane fraction in buffer containing 1% DDM, 150 mM NaCl, 50 mM Tris pH 8.0

  • Perform initial purification via immobilized metal affinity chromatography (IMAC)

  • Further purify using size exclusion chromatography

  • Validate protein folding using circular dichroism spectroscopy

  • Confirm membrane integration capacity using liposome association assays

For highest purity and activity, consider reconstituting the purified protein into nanodiscs or proteoliposomes, which provide a membrane-like environment that better maintains native conformation and activity .

What experimental approaches are most effective for studying SMA2's role in yeast sporulation?

A comprehensive investigation of SMA2's role requires multiple complementary approaches:

Experimental ApproachApplicationsKey AdvantagesLimitations
Fluorescence microscopyTrack SMA2 localization during sporulationReal-time visualizationLimited resolution
Electron microscopyExamine membrane ultrastructure changesNanometer resolutionFixed samples only
Genetic manipulationGenerate knockout/knockdown strainsDefinitive functional evidenceCompensatory mechanisms may occur
LipidomicsAnalyze membrane composition changesQuantitative lipid profilesComplex data interpretation
In vitro reconstitutionTest minimal requirements for functionControlled conditionsMay not reflect in vivo complexity
Temperature-sensitive allelesStudy protein function at different stagesTemporal control of functionDifficult to generate

A particularly powerful approach combines time-resolved fluorescence microscopy with synchronous sporulation to track SMA2 dynamics throughout the sporulation process. By tagging SMA2 with fluorescent proteins like mNeonGreen (which minimally impacts function), researchers can observe its recruitment to the prospore membrane precursors and subsequent role in membrane expansion.

For definitive functional evidence, comparing sporulation efficiency and membrane morphology between wild-type and SMA2 mutant strains provides critical insights. Complementation with various SMA2 constructs can then identify essential functional domains and residues critical for proper membrane assembly .

What are the optimal protocols for detecting and quantifying SMA2 protein expression?

Accurate detection and quantification of SMA2 expression can be achieved through several complementary methods:

MethodSensitivitySpecificityQuantitative?Sample Requirements
Western blotMediumHighSemi-quantitative10-20 μg total protein
ELISAHighHighHighly quantitative1-5 μg total protein
Mass spectrometryHighVery highQuantitative50-100 μg total protein
Flow cytometryMediumMedium-highQuantitativeIntact cells (1×10^6)
qRT-PCR (mRNA)Very highHighQuantitative0.1-1 μg total RNA

Recommended Western blot protocol for SMA2 detection:

  • Prepare membrane-enriched fractions using differential centrifugation

  • Solubilize membrane proteins in buffer containing 1% SDS or 1% DDM

  • Separate proteins on 10-12% SDS-PAGE gels

  • Transfer to PVDF membrane (preferred over nitrocellulose for hydrophobic proteins)

  • Block with 5% BSA (more effective than milk for membrane proteins)

  • Probe with anti-SMA2 antibody or anti-tag antibody if using tagged recombinant protein

  • Visualize using appropriate secondary antibody and detection system

For most accurate quantification, use an ELISA-based approach with recombinant SMA2 standards to generate a calibration curve. When analyzing expression in yeast cells undergoing sporulation, time-course sampling is essential as SMA2 expression is dynamically regulated during the sporulation process .

How can I design experiments to investigate SMA2 membrane integration and topology?

Understanding SMA2's membrane integration and topology requires specialized experimental approaches:

  • Protease protection assays:

    • Treat intact membrane vesicles with proteases (trypsin, proteinase K)

    • Analyze protected fragments by Western blot

    • Compare with detergent-solubilized samples

    • Identifies cytoplasmic vs. lumenal domains

  • Cysteine accessibility methods:

    • Generate cysteine substitutions throughout protein

    • Treat with membrane-permeable and impermeable thiol reagents

    • Identify labeled positions by mass spectrometry

    • Maps transmembrane topology

  • Fluorescence approaches:

    • Create GFP fusions at N and C termini

    • Use pH-sensitive fluorescent proteins to identify lumenal vs. cytosolic domains

    • Analyze by confocal microscopy

  • Computational prediction validation:

    • Compare experimental results with predictions from:

      • TMHMM

      • Phobius

      • TOPCONS

    • Resolve discrepancies with additional experimental data

Based on available sequence data, SMA2 is predicted to contain multiple transmembrane domains. Experimental validation should focus on determining both the number of membrane spans and the orientation of the N and C termini. This information is critical for understanding how SMA2 functions in membrane organization during sporulation and which domains interact with other proteins or lipids .

What genetic approaches can be used to study SMA2 function in vivo?

Genetic manipulation provides powerful insights into SMA2 function:

Recommended experimental design for structure-function analysis:

  • Generate a library of SMA2 variants with:

    • Systematic alanine scanning mutations

    • Domain deletions

    • Point mutations at conserved residues

  • Transform these constructs into SMA2-deletion strains

  • Quantify sporulation efficiency using standard sporulation assays

  • Assess spore viability through tetrad dissection

  • Examine membrane morphology by electron microscopy

  • Correlate functional defects with specific protein regions

For studying temporal aspects of SMA2 function, placing the gene under control of an inducible promoter (such as GAL1) allows precise timing of expression initiation. This approach can determine when SMA2 expression is critical during the sporulation process and whether it has distinct functions at different stages .

Why might recombinant SMA2 show poor solubility, and how can this be addressed?

Poor solubility of recombinant SMA2 is a common challenge due to its membrane protein nature:

ProblemPossible CausesSolutions
Protein aggregationHydrophobic transmembrane domainsTry different detergents (DDM, LMNG, Triton X-100)
Inclusion body formationOverexpression, poor foldingLower induction temperature (16-18°C), reduce IPTG concentration
Low extraction efficiencyInefficient cell lysisOptimize lysis conditions (sonication parameters, pressure)
Precipitation during purificationBuffer incompatibilityScreen buffer conditions (pH 6.5-8.5, NaCl 100-500 mM)
Loss during concentrationAdsorption to surfacesAdd 0.01% detergent to prevent surface adsorption
Aggregation after tag removalDestabilizationMaintain detergent above CMC throughout purification

Recommended solubilization strategy:

  • Express SMA2 with a solubility-enhancing tag (MBP or SUMO)

  • Harvest cells and prepare membrane fraction via ultracentrifugation

  • Solubilize membranes in buffer containing:

    • 50 mM Tris-HCl, pH 8.0

    • 150 mM NaCl

    • 10% glycerol

    • 1% DDM (or detergent mixture)

    • 1 mM DTT

    • Protease inhibitor cocktail

  • Incubate with gentle rotation at 4°C for 2-3 hours

  • Remove insoluble material by ultracentrifugation

  • Proceed with affinity purification

For particularly challenging constructs, consider using membrane scaffold proteins to create nanodiscs or amphipathic polymers like SMALPs (Styrene Maleic Acid Lipid Particles) that can extract membrane proteins with their native lipid environment intact .

How can I differentiate between specific and non-specific interactions in SMA2 binding studies?

Distinguishing legitimate interactions from experimental artifacts requires rigorous controls:

Control TypeImplementationRationale
Negative controlsEmpty vector, unrelated membrane proteinIdentifies background/non-specific binding
Competition assaysAdd excess unlabeled proteinSpecific interactions are competitively inhibited
Mutational analysisAlter key residues in binding interfaceSpecific interactions are disrupted by targeted mutations
Reciprocal co-IPPull down with antibodies to both proteinsConfirms interaction from both perspectives
Detergent sensitivityTest interaction in different detergentsTrue interactions often persist across detergent conditions
Salt sensitivityVary ionic strength in binding bufferElectrostatic artifacts are salt-sensitive

Recommended experimental design for validating protein-protein interactions:

  • Perform initial interaction screen (co-IP, pull-down, or Y2H)

  • Validate positive hits using at least two orthogonal methods

  • Map interaction domains using truncation constructs

  • Confirm specificity through competition assays

  • Demonstrate functional relevance through mutagenesis

  • Visualize interaction in vivo using techniques like BiFC

When studying membrane protein interactions, detergent choice is particularly critical. Use mild detergents like DDM or digitonin that preserve protein-protein interactions. Always include membrane protein controls that are not expected to interact with SMA2 to establish background binding levels .

What are common pitfalls in analyzing SMA2 function during sporulation and how can they be avoided?

Studying SMA2 during sporulation presents unique challenges:

PitfallManifestationMitigation Strategy
Asynchronous sporulationHeterogeneous cell populationsUse optimized synchronization protocols; single-cell analysis
Variable sporulation efficiencyInconsistent results between experimentsStandardize media composition and culture conditions
Pleiotropic effectsUnclear if phenotype is direct or indirectUse rapid depletion systems (AID, anchor-away)
Strain background differencesConflicting results between labsUse multiple strain backgrounds; clear reporting of strains
Compensatory mechanismsMasked phenotypesGenerate double/triple mutants; acute protein depletion
Technical artifactsMisinterpreted localizationUse multiple tagging strategies; validate with antibody staining

Best practices for sporulation experiments:

  • Standardize pre-growth conditions (carbon source, cell density)

  • Use synchronized cultures (verified by budding index)

  • Include positive and negative control strains in each experiment

  • Quantify multiple sporulation parameters:

    • Tetrad formation efficiency

    • Spore viability

    • Membrane morphology

    • Temporal progression

  • Combine genetic analysis with live-cell imaging

  • Validate key findings in multiple strain backgrounds

For microscopy studies, it's critical to differentiate between true membrane localization and artifactual aggregation. Controls should include membrane markers and careful analysis of protein distribution throughout the sporulation process. Time-course experiments are essential, as SMA2 function may vary at different stages of sporulation .

What emerging technologies could advance our understanding of SMA2 structure and function?

Several cutting-edge approaches offer promising avenues for SMA2 research:

TechnologyApplication to SMA2Expected Insights
Cryo-electron microscopyHigh-resolution structural analysisTransmembrane domain arrangement; protein-lipid interfaces
AlphaFold2/RoseTTAFoldComputational structure predictionFull structural model; interaction surface prediction
Hydrogen-deuterium exchange MSConformational dynamicsFlexible regions; conformational changes during function
Optical tweezers/AFMSingle-molecule mechanicsForces involved in membrane deformation
Correlative light-electron microscopyIn situ localizationPrecise spatial organization during sporulation
In-cell NMRStructural information in native environmentDynamic behavior in cellular context

Advances in membrane protein structural biology, particularly cryo-EM, now enable determination of structures previously considered intractable. For SMA2, obtaining a high-resolution structure would significantly advance understanding of its mechanism in membrane assembly. Integration of structural data with functional assays and computational simulations could reveal how SMA2 contributes to membrane curvature generation or domain organization during sporulation.

Additionally, developments in in situ cryo-electron tomography could allow visualization of SMA2 in its native membrane environment during different stages of spore formation, providing unprecedented insights into its spatial organization and interactions with other components of the sporulation machinery .

How might comparative studies across fungal species enhance our understanding of SMA2 function?

Evolutionary analysis offers valuable insights into SMA2 function:

ApproachMethodologyExpected Outcomes
Phylogenetic analysisSequence comparison across speciesIdentification of conserved functional domains
Complementation studiesCross-species gene replacementFunctional conservation assessment
Adaptive evolution analysisdN/dS ratio calculationDetection of selection pressures
Structural comparisonHomology modeling across speciesConservation of structural features
Expression pattern comparisonTranscriptomics during sporulationConservation of regulatory mechanisms

The SMA2 gene appears to be conserved across diverse fungal lineages, suggesting an ancient and fundamental role in sporulation. Comparative genomics could identify absolutely conserved residues likely essential for function. Interesting research questions include:

  • Do SMA2 homologs in different fungal species show similar membrane topology?

  • Are the expression patterns during sporulation conserved across species?

  • Can SMA2 from one species complement deletion mutations in another?

  • Do species with different spore morphologies show corresponding differences in SMA2 structure?

Such comparative analyses could distinguish between core functional elements of SMA2 and species-specific adaptations, providing deeper insights into the fundamental mechanisms of spore membrane assembly across fungi .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.