Recombinant Kluyveromyces lactis V-type proton ATPase 16 kDa proteolipid subunit 2 (VMA11) is a key component of the vacuolar ATPase (V-ATPase) complex, a multisubunit enzyme responsible for acidifying intracellular compartments and energizing proton-coupled transport across membranes . This subunit forms part of the V₀ membrane-integral sector, which facilitates proton translocation through a rotary mechanism . The recombinant form is produced in Escherichia coli with an N-terminal His-tag, enabling purification and research applications .
Amino Acid Sequence:
The full-length protein comprises 165 residues (UniProt ID: Q6CT28) with the sequence:
MSQAISEDQYAPLFAPFFGFAGCAFAMILSCLGAAIGTAKSGIGISGIGTFKPELIMKSLIPVVMSGILAVYGLVVAVLIAGGLSPTEDYTLFNGFMHLSCGLCVGFACLSSGYAIGIVGDVGVRKYMHQPRLFVGIVLILIFSEVLGLYGMIVALILNTRGSGN .
Molecular Weight: ~16 kDa (consistent with its classification as a proteolipid subunit) .
Proteolipid Ring: Forms a hexameric ring within the V₀ sector, creating a proton-conducting pore .
Transmembrane Helices: Four helices per subunit, critical for proton translocation .
| Parameter | Specification |
|---|---|
| Expression Host | E. coli |
| Tag | N-terminal His-tag |
| Purity | >90% (SDS-PAGE) |
| Form | Lyophilized powder |
| Storage Buffer | Tris/PBS-based buffer, 6% Trehalose |
| Reconstitution | 0.1–1.0 mg/mL in sterile water + 50% glycerol |
| Storage | -20°C/-80°C (avoid freeze-thaw cycles) |
Role in V-ATPase Assembly: Interacts with assembly factors (e.g., Vma21p) to stabilize the proteolipid ring .
Proton Transport: Essential for rotational coupling between the V₀ and V₁ sectors during ATP hydrolysis .
Mechanistic Studies: Used to investigate V-ATPase structure-function relationships, particularly proton translocation mechanisms .
Drug Discovery: Serves as a target for inhibitors of fungal V-ATPases, which are potential antifungals .
Biochemical Assays: Acts as a positive control in Western blotting or ELISA due to its His-tag .
| Feature | K. lactis VMA11 | Saccharomyces cerevisiae VMA11 |
|---|---|---|
| Amino Acid Length | 165 residues | 164 residues |
| UniProt ID | Q6CT28 | P25515 |
| Proton Channel | Conserved transmembrane helices | Similar structural topology |
| Expression System | E. coli (recombinant) | Native yeast systems |
Stability: Requires strict storage conditions (-80°C) to prevent aggregation .
Functional Studies: Requires reconstitution into lipid bilayers for proton transport assays, complicating in vitro analyses .
KEGG: kla:KLLA0C15917g
STRING: 284590.XP_452911.1
VMA11 is a 16 kDa proteolipid subunit of the V-type proton ATPase complex in K. lactis, functioning within the membrane-embedded V0 domain. This subunit is critical for proton translocation across membranes and contributes to maintaining pH homeostasis within cellular compartments. Unlike in Saccharomyces cerevisiae, where some genes have aerobic/hypoxic duplicates, K. lactis generally maintains single copies of genes regulated by oxygen availability . The VMA11 protein participates in the acidification of intracellular compartments, which is essential for various cellular processes including protein sorting, receptor-mediated endocytosis, and protein degradation. The functional integrity of VMA11 is particularly important in K. lactis, which primarily relies on respiratory metabolism rather than fermentation.
Recombinant expression of VMA11 in K. lactis typically involves integration of the expression cassette into the K. lactis genome, as demonstrated by the integration mechanism used for other recombinant proteins in K. lactis . This integration often occurs at specific loci, such as the LAC4 promoter region, allowing for galactose-inducible expression. The expression levels of recombinant VMA11 can be significantly higher than native expression, potentially affecting cellular pH regulation and protein trafficking. When designing recombinant VMA11 expression systems, researchers should consider using vectors such as pKLAC1, which has been successfully employed for other recombinant proteins in K. lactis . The expression is typically verified through PCR amplification of the integrated expression cassette and functional assays measuring V-ATPase activity.
K. lactis offers several distinct advantages as a host for recombinant VMA11 expression:
Food-grade safety status, making it suitable for producing proteins for therapeutic or nutritional applications
Predominantly respiratory metabolism, which can lead to higher biomass yield and potentially higher protein production
Ability to grow on various carbon sources beyond glucose
Different oxidative stress response regulation compared to S. cerevisiae, which may affect protein folding and stability
Generally simpler genetic background without whole genome duplication events that occurred in S. cerevisiae
Notably, K. lactis differs from S. cerevisiae in its oxidative stress response mechanisms, with different regulatory patterns for key enzymes like glutathione reductase, superoxide dismutase, and catalases . This metabolic difference may influence protein expression under various growth conditions. K. lactis also typically performs better in protein secretion for certain proteins due to differences in post-translational modifications and secretory pathway efficiency.
The optimal vector systems for expressing recombinant VMA11 in K. lactis include:
The pKLAC1 vector system is particularly effective, as demonstrated in similar recombinant protein expression studies in K. lactis . For VMA11 expression, the construction process would follow similar methodologies to those used for other recombinant proteins in K. lactis, including restriction digestion with appropriate enzymes (such as BglII and SalI), ligation, and transformation into E. coli for plasmid amplification before transformation into K. lactis . After transformation, selection of positive transformants typically involves growth on YCB agar medium containing acetamide, followed by PCR verification of integration.
Purification of recombinant VMA11 from K. lactis requires specialized approaches to maintain structural integrity and functional activity:
Initial Cell Disruption: Mechanical disruption using glass beads in a buffer containing 50mM Tris-HCl (pH 7.5), 200mM NaCl, 1mM EDTA, and protease inhibitors is recommended for K. lactis, which has a more rigid cell wall than S. cerevisiae.
Membrane Fraction Isolation: Differential centrifugation at 10,000×g followed by ultracentrifugation at 100,000×g to isolate membrane fractions containing VMA11.
Detergent Solubilization: Carefully solubilize using 1% n-dodecyl-β-D-maltoside or 0.5% digitonin in solubilization buffer (50mM Tris-HCl pH 7.5, 150mM NaCl, 10% glycerol).
Affinity Chromatography: If the recombinant VMA11 includes affinity tags such as GST (as used in other K. lactis recombinant proteins ), affinity chromatography can be employed for initial purification.
Size Exclusion Chromatography: Further purification using size exclusion chromatography to separate monomeric VMA11 from aggregates or other protein complexes.
The purity and activity assessment should include SDS-PAGE analysis, western blotting with anti-VMA11 antibodies, and functional assays measuring ATP hydrolysis and proton pumping activity.
Optimizing induction conditions for VMA11 expression in K. lactis requires systematic adjustment of multiple parameters:
Based on protocols for other recombinant proteins in K. lactis, cultivation in YEPD liquid medium until reaching an OD600 of approximately 1.0, followed by transfer to YEPG induction medium is effective . The optimal induction time should be determined empirically by sampling at various time points and analyzing VMA11 expression using western blotting and activity assays. Unlike S. cerevisiae, K. lactis has different responses to hypoxic conditions, which may affect recombinant protein expression . Therefore, maintaining adequate aeration during cultivation is particularly important.
VMA11 from K. lactis shares structural similarities with homologous V-ATPase subunits in other yeasts, but exhibits distinct functional characteristics:
| Species | Homolog | Sequence Identity | Key Structural Differences | Functional Implications |
|---|---|---|---|---|
| K. lactis | VMA11 | 100% (reference) | Reference structure | Primary research subject |
| S. cerevisiae | Vma11p | ~80-85% | Different transmembrane domain organization | Different pH sensitivity |
| C. albicans | VMA11 | ~75-80% | Variation in cytoplasmic loops | Potential pathogenicity role |
| P. pastoris | VMA11 | ~70-75% | More hydrophobic core residues | Potentially greater stability |
The functional differences between K. lactis VMA11 and homologs in other yeasts likely arise from the unique metabolic characteristics of K. lactis, particularly its respiratory preference and different oxidative stress response mechanisms . Unlike S. cerevisiae, which underwent whole genome duplication and has specialized genes for aerobic and hypoxic conditions, K. lactis maintains single copies of genes that are regulated in response to environmental conditions . This suggests that K. lactis VMA11 may need to function effectively across a broader range of cellular conditions. Experimental studies comparing V-ATPase activity under various stress conditions would provide valuable insights into these functional differences.
Mutations in VMA11 significantly impact K. lactis cellular physiology due to the central role of V-ATPase in cellular pH homeostasis:
pH Sensitivity: VMA11 mutations typically result in growth defects at both alkaline and acidic pH extremes, as the V-ATPase complex is essential for maintaining pH gradients across organellar membranes.
Metal Ion Tolerance: Decreased tolerance to high concentrations of Ca²⁺, Zn²⁺, and Fe²⁺, as V-ATPase activity influences metal ion compartmentalization.
Oxidative Stress Response: Unlike S. cerevisiae, K. lactis has different regulatory patterns for oxidative stress response enzymes . VMA11 mutations may disrupt this balance by affecting vacuolar function, potentially altering glutathione metabolism and ROS detoxification pathways.
Carbon Source Utilization: VMA11 mutations can affect growth on different carbon sources, particularly those requiring respiratory metabolism, which is predominant in K. lactis .
Protein Sorting and Secretion: Defects in protein trafficking and secretion, as proper organellar acidification is required for these processes.
Notably, the impacts of VMA11 mutations in K. lactis would likely differ from those in S. cerevisiae due to the distinct metabolic preferences and stress response mechanisms between these yeasts . While both yeasts would show defects in vacuolar acidification, the downstream consequences on cellular metabolism would depend on the specific metabolic networks affected.
Computational structural biology provides powerful tools for rational design of VMA11 mutations:
Homology Modeling: Generating K. lactis VMA11 structural models based on crystallographic data from related V-ATPase subunits allows identification of critical structural elements.
Molecular Dynamics Simulations: Simulating VMA11 behavior within lipid bilayers under various conditions (pH, temperature, membrane composition) can identify regions susceptible to unfolding or instability.
In silico Mutagenesis and Energy Calculations: Systematic computational mutagenesis can predict stabilizing mutations by calculating changes in folding free energy (ΔΔG).
Protein-Protein Interaction Interface Analysis: Identifying residues involved in VMA11 interactions with other V-ATPase subunits to engineer improved complex assembly.
Research involving recombinant K. lactis VMA11 is subject to specific NIH guidelines:
General Applicability: Research conducted at or sponsored by institutions receiving NIH support for recombinant nucleic acid research must follow NIH Guidelines .
Containment Requirements: K. lactis is generally considered a Biosafety Level 1 (BSL-1) organism, but recombinant strains expressing VMA11 should be evaluated based on the specific construct and experimental design.
Institutional Review: Experiments require review by an Institutional Biosafety Committee (IBC) as outlined in Section I-C-1-a-(1) of the NIH Guidelines .
Registration and Approval: Research plans must be registered with the IBC, and for certain higher-risk experiments, NIH approval may be required before initiation.
Human Testing Considerations: If materials containing recombinant VMA11 will be tested in humans, additional requirements apply under Section I-C-1-a-(2) .
To ensure compliance with institutional biosafety requirements:
Risk Assessment: Conduct a comprehensive risk assessment addressing:
Biological properties of K. lactis
Nature and function of the recombinant VMA11 construct
Potential for adverse effects on human health or environment
Containment measures appropriate for the assessed risk
Protocol Development:
Define specific standard operating procedures (SOPs) for handling recombinant K. lactis
Include detailed waste management and decontamination protocols
Establish emergency procedures for potential spills or exposures
Institutional Approval Process:
Submit research protocol to the Institutional Biosafety Committee (IBC)
Provide detailed documentation of:
a) Vector construction and recombinant DNA introduced
b) Expression system and promoters used
c) Selection markers and antibiotic resistance genes
d) Containment facilities and equipment available
Laboratory Practices:
Implement basic BSL-1 practices with additional measures as required
Maintain detailed experimental records and strain databases
Ensure proper labeling of all recombinant materials
As specified in NIH Guidelines Section I-C-1-a-(1), institutions receiving NIH support must assume responsibilities for biosafety oversight of recombinant nucleic acid research . Researchers should consult with their institutional biosafety officers early in the experimental design process to ensure all requirements are appropriately addressed.
Common issues and solutions for recombinant VMA11 expression in K. lactis include:
For troubleshooting low expression levels, strategies similar to those used for other recombinant proteins in K. lactis can be applied . This includes optimizing induction conditions such as temperature, time, and media composition. For protein aggregation issues, which are common with membrane proteins like VMA11, the addition of a solubility tag such as GST may be beneficial, as demonstrated in other K. lactis recombinant protein expression systems .
Accurate quantification and functional assessment of recombinant VMA11 requires multiple complementary approaches:
Quantitative Methods:
Western blotting with specific anti-VMA11 antibodies using purified VMA11 standards for calibration
Mass spectrometry-based quantification using labeled reference peptides
Fluorescence-based approaches if GFP-tagged constructs are employed
Functional Activity Assays:
ATP hydrolysis assays measuring phosphate release with colorimetric methods
Proton pumping assays using pH-sensitive fluorescent dyes (e.g., ACMA)
Vacuolar acidification measurements in intact cells using ratiometric pH indicators
Structural Integrity Assessment:
Blue native PAGE to verify correct assembly into V-ATPase complex
Proteolytic digestion patterns to confirm proper folding
Circular dichroism to assess secondary structure composition
Cellular Phenotypic Assays:
Growth tests at various pH values (pH 5.5-8.0)
Metal sensitivity assays (particularly Ca²⁺ and Zn²⁺)
Vacuolar morphology visualization using specific dyes
The most informative approach combines direct biochemical measurements of purified VMA11 with cellular assays that assess V-ATPase function in vivo. Similar methodological considerations would apply to those used for assessment of other recombinant proteins expressed in K. lactis , with adaptations specific to membrane proteins and V-ATPase function.
Essential experimental controls for studying recombinant VMA11 function include:
Genetic Controls:
Wild-type K. lactis strain (expressing native VMA11)
VMA11 deletion mutant (complete loss of function)
K. lactis strain with empty expression vector (vector-only control)
Strains expressing known VMA11 mutants with characterized phenotypes
Biochemical Controls:
Specific V-ATPase inhibitors (e.g., bafilomycin A1, concanamycin A) to confirm specificity of activity measurements
ATPase assays performed with and without V-ATPase-specific inhibitors
Heat-inactivated enzyme preparations to establish baseline activity
Purified V-ATPase from other sources as positive control
Experimental Condition Controls:
Time-course sampling to establish kinetics
Range of substrate concentrations for enzymatic assays
pH series to determine optimal conditions and pH-dependent activity
Variation of metal ion concentrations (particularly Mg²⁺)
Expression Verification Controls:
RT-qPCR to confirm transcription levels
Western blots with appropriate loading controls
Immunolocalization to verify correct subcellular targeting
These controls help distinguish VMA11-specific effects from general perturbations of cellular physiology or technical artifacts. Similar control strategies have been employed in studies of other recombinant proteins expressed in K. lactis , though adapted for the specific challenges of membrane protein expression and V-ATPase function analysis.
Recombinant K. lactis VMA11 offers several advantages for structural biology studies:
Cryo-EM Analysis:
K. lactis V-ATPase containing recombinant VMA11 can be purified for single-particle cryo-EM studies
VMA11 can be modified with specific tags for improved particle orientation determination
Site-directed mutations can probe structural dynamics during catalytic cycle
X-ray Crystallography Applications:
Recombinant VMA11 expression can be optimized for crystallization trials
Systematic mutagenesis guided by computational analysis can identify constructs with improved crystallization properties
Co-crystallization with specific inhibitors can provide insights into binding sites
Hybrid Structural Approaches:
Integrating hydrogen-deuterium exchange mass spectrometry (HDX-MS) with cryo-EM
Combining cross-linking mass spectrometry (XL-MS) with molecular modeling
Using solid-state NMR to study specific labeled residues in membrane environment
Structural Dynamics:
Time-resolved cryo-EM to capture different conformational states
FRET-based approaches to monitor conformational changes during catalytic cycle
Molecular dynamics simulations validated by experimental data
The development of improved protocols for membrane protein expression in K. lactis, as has been done for other recombinant proteins , would significantly advance structural biology applications. The respiratory preference of K. lactis may offer advantages for expressing membrane proteins like VMA11 compared to fermentative yeasts .
Engineered K. lactis VMA11 variants offer powerful tools for investigating pH-dependent cellular processes:
pH Sensor Development:
Creating VMA11 variants with altered pH sensitivity to fine-tune vacuolar acidification
Developing strains with precisely controlled organellar pH for studying pH-dependent processes
Engineering pH-responsive regulatory circuits based on VMA11 function
Disease Model Applications:
Modeling human diseases associated with V-ATPase dysfunction
Creating platforms for screening potential therapeutics targeting V-ATPase function
Investigating cellular responses to pH dysregulation
Metabolic Engineering:
Manipulating intracellular pH to optimize production of pH-sensitive compounds
Engineering strains with altered pH homeostasis for specialized fermentation processes
Studying the relationship between pH gradients and cellular energy dynamics
Stress Response Investigations:
The food-grade status of K. lactis combined with its distinct metabolic and stress response characteristics compared to S. cerevisiae make it particularly valuable for these applications, potentially offering insights not readily obtainable in other model systems.
Cross-disciplinary approaches can significantly advance VMA11 research:
Systems Biology Integration:
Multi-omics analysis (transcriptomics, proteomics, metabolomics) of K. lactis expressing recombinant VMA11 variants
Flux balance analysis to understand metabolic impacts of V-ATPase dysfunction
Network modeling to identify regulatory connections between V-ATPase activity and other cellular systems
Synthetic Biology Applications:
Developing synthetic regulatory circuits controlled by organellar pH
Creating modular expression systems for optimal membrane protein production in K. lactis
Engineering biosensors based on VMA11 conformational changes
Advanced Microscopy Techniques:
Super-resolution microscopy to visualize V-ATPase distribution and dynamics
Correlative light and electron microscopy (CLEM) to connect function with ultrastructure
Live-cell imaging with pH-sensitive probes to monitor V-ATPase activity in real-time
Computational Biology Approaches:
Machine learning to predict VMA11 variants with desired properties
Molecular simulations of the entire V-ATPase complex in membrane environments
Quantum mechanical calculations to understand proton translocation mechanisms
Evolutionary Biology Perspectives:
These interdisciplinary approaches build upon established methodologies for recombinant protein expression in K. lactis and can leverage the unique metabolic and stress response characteristics of this yeast to develop novel research tools and applications.