Recombinant Kluyveromyces lactis V-type proton ATPase 16 kDa proteolipid subunit 2 (VMA11)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant Kluyveromyces lactis V-type proton ATPase 16 kDa proteolipid subunit 2 (VMA11) is a key component of the vacuolar ATPase (V-ATPase) complex, a multisubunit enzyme responsible for acidifying intracellular compartments and energizing proton-coupled transport across membranes . This subunit forms part of the V₀ membrane-integral sector, which facilitates proton translocation through a rotary mechanism . The recombinant form is produced in Escherichia coli with an N-terminal His-tag, enabling purification and research applications .

Primary Structure

  • Amino Acid Sequence:
    The full-length protein comprises 165 residues (UniProt ID: Q6CT28) with the sequence:
    MSQAISEDQYAPLFAPFFGFAGCAFAMILSCLGAAIGTAKSGIGISGIGTFKPELIMKSLIPVVMSGILAVYGLVVAVLIAGGLSPTEDYTLFNGFMHLSCGLCVGFACLSSGYAIGIVGDVGVRKYMHQPRLFVGIVLILIFSEVLGLYGMIVALILNTRGSGN .

  • Molecular Weight: ~16 kDa (consistent with its classification as a proteolipid subunit) .

Domain Organization

  • Proteolipid Ring: Forms a hexameric ring within the V₀ sector, creating a proton-conducting pore .

  • Transmembrane Helices: Four helices per subunit, critical for proton translocation .

Production and Purification

ParameterSpecification
Expression HostE. coli
TagN-terminal His-tag
Purity>90% (SDS-PAGE)
FormLyophilized powder
Storage BufferTris/PBS-based buffer, 6% Trehalose
Reconstitution0.1–1.0 mg/mL in sterile water + 50% glycerol
Storage-20°C/-80°C (avoid freeze-thaw cycles)

Functional Insights

  • Role in V-ATPase Assembly: Interacts with assembly factors (e.g., Vma21p) to stabilize the proteolipid ring .

  • Proton Transport: Essential for rotational coupling between the V₀ and V₁ sectors during ATP hydrolysis .

Research Applications

  1. Mechanistic Studies: Used to investigate V-ATPase structure-function relationships, particularly proton translocation mechanisms .

  2. Drug Discovery: Serves as a target for inhibitors of fungal V-ATPases, which are potential antifungals .

  3. Biochemical Assays: Acts as a positive control in Western blotting or ELISA due to its His-tag .

Comparative Analysis with Homologs

FeatureK. lactis VMA11Saccharomyces cerevisiae VMA11
Amino Acid Length165 residues164 residues
UniProt IDQ6CT28P25515
Proton ChannelConserved transmembrane helicesSimilar structural topology
Expression SystemE. coli (recombinant)Native yeast systems

Challenges and Limitations

  • Stability: Requires strict storage conditions (-80°C) to prevent aggregation .

  • Functional Studies: Requires reconstitution into lipid bilayers for proton transport assays, complicating in vitro analyses .

Future Directions

  • Cryo-EM Studies: High-resolution structural analysis to elucidate rotational mechanics.

  • Pathogen Targeting: Exploiting fungal-specific V-ATPase features for antifungal development .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for the most accurate delivery timeframe.
All our proteins are shipped with standard blue ice packs. Should you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us and we will prioritize its development.
Synonyms
VMA11; KLLA0C15917g; V-type proton ATPase 16 kDa proteolipid subunit 2; V-ATPase 16 kDa proteolipid subunit 2; Proteolipid protein VMA11; Vacuolar proton pump 16 kDa proteolipid subunit 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-165
Protein Length
full length protein
Species
Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)
Target Names
VMA11
Target Protein Sequence
MSQAISEDQYAPLFAPFFGFAGCAFAMILSCLGAAIGTAKSGIGISGIGTFKPELIMKSL IPVVMSGILAVYGLVVAVLIAGGLSPTEDYTLFNGFMHLSCGLCVGFACLSSGYAIGIVG DVGVRKYMHQPRLFVGIVLILIFSEVLGLYGMIVALILNTRGSGN
Uniprot No.

Target Background

Function
The V-type proton ATPase is a multi-subunit enzyme that plays a critical role in acidifying various intracellular compartments within eukaryotic cells. The 16 kDa proteolipid subunit 2 (VMA11) is a proton-conducting pore-forming subunit of the V0 complex, a membrane-integral component of the V-ATPase.
Database Links
Protein Families
V-ATPase proteolipid subunit family
Subcellular Location
Vacuole membrane; Multi-pass membrane protein.

Q&A

What is the role of VMA11 in Kluyveromyces lactis cellular function?

VMA11 is a 16 kDa proteolipid subunit of the V-type proton ATPase complex in K. lactis, functioning within the membrane-embedded V0 domain. This subunit is critical for proton translocation across membranes and contributes to maintaining pH homeostasis within cellular compartments. Unlike in Saccharomyces cerevisiae, where some genes have aerobic/hypoxic duplicates, K. lactis generally maintains single copies of genes regulated by oxygen availability . The VMA11 protein participates in the acidification of intracellular compartments, which is essential for various cellular processes including protein sorting, receptor-mediated endocytosis, and protein degradation. The functional integrity of VMA11 is particularly important in K. lactis, which primarily relies on respiratory metabolism rather than fermentation.

How does recombinant expression of VMA11 differ from native expression in K. lactis?

Recombinant expression of VMA11 in K. lactis typically involves integration of the expression cassette into the K. lactis genome, as demonstrated by the integration mechanism used for other recombinant proteins in K. lactis . This integration often occurs at specific loci, such as the LAC4 promoter region, allowing for galactose-inducible expression. The expression levels of recombinant VMA11 can be significantly higher than native expression, potentially affecting cellular pH regulation and protein trafficking. When designing recombinant VMA11 expression systems, researchers should consider using vectors such as pKLAC1, which has been successfully employed for other recombinant proteins in K. lactis . The expression is typically verified through PCR amplification of the integrated expression cassette and functional assays measuring V-ATPase activity.

What are the advantages of using K. lactis as a host for recombinant VMA11 expression compared to other yeast systems?

K. lactis offers several distinct advantages as a host for recombinant VMA11 expression:

  • Food-grade safety status, making it suitable for producing proteins for therapeutic or nutritional applications

  • Predominantly respiratory metabolism, which can lead to higher biomass yield and potentially higher protein production

  • Ability to grow on various carbon sources beyond glucose

  • Different oxidative stress response regulation compared to S. cerevisiae, which may affect protein folding and stability

  • Generally simpler genetic background without whole genome duplication events that occurred in S. cerevisiae

Notably, K. lactis differs from S. cerevisiae in its oxidative stress response mechanisms, with different regulatory patterns for key enzymes like glutathione reductase, superoxide dismutase, and catalases . This metabolic difference may influence protein expression under various growth conditions. K. lactis also typically performs better in protein secretion for certain proteins due to differences in post-translational modifications and secretory pathway efficiency.

What are the optimal vector systems and promoters for expressing recombinant VMA11 in K. lactis?

The optimal vector systems for expressing recombinant VMA11 in K. lactis include:

Vector SystemPromoter TypeInduction MethodIntegration SiteKey Features
pKLAC1PLAC4-PBIGalactoseLAC4 locusHigh-level expression, stable integration
pKLAC2PLAC4-PBIGalactoseLAC4 locusIncludes α-mating factor secretion signal
pKLP1PADH1ConstitutiveMultiple possibleDoesn't require galactose induction
pKLJC/pKLDPLAC4-PBIGalactoseK1 killer toxin locusMaintains killer phenotype

The pKLAC1 vector system is particularly effective, as demonstrated in similar recombinant protein expression studies in K. lactis . For VMA11 expression, the construction process would follow similar methodologies to those used for other recombinant proteins in K. lactis, including restriction digestion with appropriate enzymes (such as BglII and SalI), ligation, and transformation into E. coli for plasmid amplification before transformation into K. lactis . After transformation, selection of positive transformants typically involves growth on YCB agar medium containing acetamide, followed by PCR verification of integration.

What purification strategies yield the highest purity and activity for recombinant VMA11 from K. lactis?

Purification of recombinant VMA11 from K. lactis requires specialized approaches to maintain structural integrity and functional activity:

  • Initial Cell Disruption: Mechanical disruption using glass beads in a buffer containing 50mM Tris-HCl (pH 7.5), 200mM NaCl, 1mM EDTA, and protease inhibitors is recommended for K. lactis, which has a more rigid cell wall than S. cerevisiae.

  • Membrane Fraction Isolation: Differential centrifugation at 10,000×g followed by ultracentrifugation at 100,000×g to isolate membrane fractions containing VMA11.

  • Detergent Solubilization: Carefully solubilize using 1% n-dodecyl-β-D-maltoside or 0.5% digitonin in solubilization buffer (50mM Tris-HCl pH 7.5, 150mM NaCl, 10% glycerol).

  • Affinity Chromatography: If the recombinant VMA11 includes affinity tags such as GST (as used in other K. lactis recombinant proteins ), affinity chromatography can be employed for initial purification.

  • Size Exclusion Chromatography: Further purification using size exclusion chromatography to separate monomeric VMA11 from aggregates or other protein complexes.

The purity and activity assessment should include SDS-PAGE analysis, western blotting with anti-VMA11 antibodies, and functional assays measuring ATP hydrolysis and proton pumping activity.

How can I optimize induction conditions for maximum VMA11 expression in recombinant K. lactis strains?

Optimizing induction conditions for VMA11 expression in K. lactis requires systematic adjustment of multiple parameters:

ParameterRecommended RangeEffect on Expression
Induction MediumYEPG (galactose)Activates PLAC4-PBI promoter
Initial Culture DensityOD600 0.8-1.0Ensures cells are in exponential phase
Galactose Concentration1-2%Higher concentrations may not improve yields
Incubation Temperature25-30°CLower temperatures may improve folding
pH4.5-6.0Affects both growth and expression
Incubation Time24-72 hoursProtein-specific optimization required
AerationHigh aerationK. lactis is primarily respiratory

Based on protocols for other recombinant proteins in K. lactis, cultivation in YEPD liquid medium until reaching an OD600 of approximately 1.0, followed by transfer to YEPG induction medium is effective . The optimal induction time should be determined empirically by sampling at various time points and analyzing VMA11 expression using western blotting and activity assays. Unlike S. cerevisiae, K. lactis has different responses to hypoxic conditions, which may affect recombinant protein expression . Therefore, maintaining adequate aeration during cultivation is particularly important.

How does VMA11 from K. lactis compare structurally and functionally to homologous subunits in other yeast species?

VMA11 from K. lactis shares structural similarities with homologous V-ATPase subunits in other yeasts, but exhibits distinct functional characteristics:

SpeciesHomologSequence IdentityKey Structural DifferencesFunctional Implications
K. lactisVMA11100% (reference)Reference structurePrimary research subject
S. cerevisiaeVma11p~80-85%Different transmembrane domain organizationDifferent pH sensitivity
C. albicansVMA11~75-80%Variation in cytoplasmic loopsPotential pathogenicity role
P. pastorisVMA11~70-75%More hydrophobic core residuesPotentially greater stability

The functional differences between K. lactis VMA11 and homologs in other yeasts likely arise from the unique metabolic characteristics of K. lactis, particularly its respiratory preference and different oxidative stress response mechanisms . Unlike S. cerevisiae, which underwent whole genome duplication and has specialized genes for aerobic and hypoxic conditions, K. lactis maintains single copies of genes that are regulated in response to environmental conditions . This suggests that K. lactis VMA11 may need to function effectively across a broader range of cellular conditions. Experimental studies comparing V-ATPase activity under various stress conditions would provide valuable insights into these functional differences.

What is the impact of VMA11 mutations on K. lactis cellular physiology and stress responses?

Mutations in VMA11 significantly impact K. lactis cellular physiology due to the central role of V-ATPase in cellular pH homeostasis:

  • pH Sensitivity: VMA11 mutations typically result in growth defects at both alkaline and acidic pH extremes, as the V-ATPase complex is essential for maintaining pH gradients across organellar membranes.

  • Metal Ion Tolerance: Decreased tolerance to high concentrations of Ca²⁺, Zn²⁺, and Fe²⁺, as V-ATPase activity influences metal ion compartmentalization.

  • Oxidative Stress Response: Unlike S. cerevisiae, K. lactis has different regulatory patterns for oxidative stress response enzymes . VMA11 mutations may disrupt this balance by affecting vacuolar function, potentially altering glutathione metabolism and ROS detoxification pathways.

  • Carbon Source Utilization: VMA11 mutations can affect growth on different carbon sources, particularly those requiring respiratory metabolism, which is predominant in K. lactis .

  • Protein Sorting and Secretion: Defects in protein trafficking and secretion, as proper organellar acidification is required for these processes.

Notably, the impacts of VMA11 mutations in K. lactis would likely differ from those in S. cerevisiae due to the distinct metabolic preferences and stress response mechanisms between these yeasts . While both yeasts would show defects in vacuolar acidification, the downstream consequences on cellular metabolism would depend on the specific metabolic networks affected.

How can computational structural biology approaches inform directed mutagenesis of K. lactis VMA11 for enhanced stability or function?

Computational structural biology provides powerful tools for rational design of VMA11 mutations:

  • Homology Modeling: Generating K. lactis VMA11 structural models based on crystallographic data from related V-ATPase subunits allows identification of critical structural elements.

  • Molecular Dynamics Simulations: Simulating VMA11 behavior within lipid bilayers under various conditions (pH, temperature, membrane composition) can identify regions susceptible to unfolding or instability.

  • In silico Mutagenesis and Energy Calculations: Systematic computational mutagenesis can predict stabilizing mutations by calculating changes in folding free energy (ΔΔG).

  • Protein-Protein Interaction Interface Analysis: Identifying residues involved in VMA11 interactions with other V-ATPase subunits to engineer improved complex assembly.

What NIH guidelines and regulations apply to research with recombinant K. lactis VMA11?

Research involving recombinant K. lactis VMA11 is subject to specific NIH guidelines:

  • General Applicability: Research conducted at or sponsored by institutions receiving NIH support for recombinant nucleic acid research must follow NIH Guidelines .

  • Containment Requirements: K. lactis is generally considered a Biosafety Level 1 (BSL-1) organism, but recombinant strains expressing VMA11 should be evaluated based on the specific construct and experimental design.

  • Institutional Review: Experiments require review by an Institutional Biosafety Committee (IBC) as outlined in Section I-C-1-a-(1) of the NIH Guidelines .

  • Registration and Approval: Research plans must be registered with the IBC, and for certain higher-risk experiments, NIH approval may be required before initiation.

  • Human Testing Considerations: If materials containing recombinant VMA11 will be tested in humans, additional requirements apply under Section I-C-1-a-(2) .

How should experiments with recombinant K. lactis VMA11 be designed to comply with institutional biosafety requirements?

To ensure compliance with institutional biosafety requirements:

  • Risk Assessment: Conduct a comprehensive risk assessment addressing:

    • Biological properties of K. lactis

    • Nature and function of the recombinant VMA11 construct

    • Potential for adverse effects on human health or environment

    • Containment measures appropriate for the assessed risk

  • Protocol Development:

    • Define specific standard operating procedures (SOPs) for handling recombinant K. lactis

    • Include detailed waste management and decontamination protocols

    • Establish emergency procedures for potential spills or exposures

  • Institutional Approval Process:

    • Submit research protocol to the Institutional Biosafety Committee (IBC)

    • Provide detailed documentation of:
      a) Vector construction and recombinant DNA introduced
      b) Expression system and promoters used
      c) Selection markers and antibiotic resistance genes
      d) Containment facilities and equipment available

  • Laboratory Practices:

    • Implement basic BSL-1 practices with additional measures as required

    • Maintain detailed experimental records and strain databases

    • Ensure proper labeling of all recombinant materials

As specified in NIH Guidelines Section I-C-1-a-(1), institutions receiving NIH support must assume responsibilities for biosafety oversight of recombinant nucleic acid research . Researchers should consult with their institutional biosafety officers early in the experimental design process to ensure all requirements are appropriately addressed.

What are common problems in recombinant K. lactis VMA11 expression systems and how can they be resolved?

Common issues and solutions for recombinant VMA11 expression in K. lactis include:

ProblemPossible CausesTroubleshooting Approaches
Low expression levelsSuboptimal codon usageOptimize codons for K. lactis preference
Weak promoter activityTest alternative promoters (e.g., PLAC4-PBI vs. PADH1)
Incorrect integrationVerify integration by PCR and sequencing
Protein aggregationImproper foldingLower induction temperature to 20-25°C
Overexpression toxicityUse inducible rather than constitutive promoters
Membrane protein challengesAdd stabilizing agents (glycerol, specific detergents)
Growth inhibitionV-ATPase imbalanceTune expression levels with different promoters
pH sensitivityCarefully buffer growth media
Cellular stress responseMonitor oxidative stress markers
Inconsistent resultsStrain instabilityVerify strain stability over multiple generations
Variable inductionStandardize induction protocols
Media composition variationsUse defined media rather than complex media

For troubleshooting low expression levels, strategies similar to those used for other recombinant proteins in K. lactis can be applied . This includes optimizing induction conditions such as temperature, time, and media composition. For protein aggregation issues, which are common with membrane proteins like VMA11, the addition of a solubility tag such as GST may be beneficial, as demonstrated in other K. lactis recombinant protein expression systems .

How can I accurately quantify and assess the functional activity of recombinant VMA11 in K. lactis?

Accurate quantification and functional assessment of recombinant VMA11 requires multiple complementary approaches:

  • Quantitative Methods:

    • Western blotting with specific anti-VMA11 antibodies using purified VMA11 standards for calibration

    • Mass spectrometry-based quantification using labeled reference peptides

    • Fluorescence-based approaches if GFP-tagged constructs are employed

  • Functional Activity Assays:

    • ATP hydrolysis assays measuring phosphate release with colorimetric methods

    • Proton pumping assays using pH-sensitive fluorescent dyes (e.g., ACMA)

    • Vacuolar acidification measurements in intact cells using ratiometric pH indicators

  • Structural Integrity Assessment:

    • Blue native PAGE to verify correct assembly into V-ATPase complex

    • Proteolytic digestion patterns to confirm proper folding

    • Circular dichroism to assess secondary structure composition

  • Cellular Phenotypic Assays:

    • Growth tests at various pH values (pH 5.5-8.0)

    • Metal sensitivity assays (particularly Ca²⁺ and Zn²⁺)

    • Vacuolar morphology visualization using specific dyes

The most informative approach combines direct biochemical measurements of purified VMA11 with cellular assays that assess V-ATPase function in vivo. Similar methodological considerations would apply to those used for assessment of other recombinant proteins expressed in K. lactis , with adaptations specific to membrane proteins and V-ATPase function.

What experimental controls are essential when studying recombinant K. lactis VMA11 function?

Essential experimental controls for studying recombinant VMA11 function include:

  • Genetic Controls:

    • Wild-type K. lactis strain (expressing native VMA11)

    • VMA11 deletion mutant (complete loss of function)

    • K. lactis strain with empty expression vector (vector-only control)

    • Strains expressing known VMA11 mutants with characterized phenotypes

  • Biochemical Controls:

    • Specific V-ATPase inhibitors (e.g., bafilomycin A1, concanamycin A) to confirm specificity of activity measurements

    • ATPase assays performed with and without V-ATPase-specific inhibitors

    • Heat-inactivated enzyme preparations to establish baseline activity

    • Purified V-ATPase from other sources as positive control

  • Experimental Condition Controls:

    • Time-course sampling to establish kinetics

    • Range of substrate concentrations for enzymatic assays

    • pH series to determine optimal conditions and pH-dependent activity

    • Variation of metal ion concentrations (particularly Mg²⁺)

  • Expression Verification Controls:

    • RT-qPCR to confirm transcription levels

    • Western blots with appropriate loading controls

    • Immunolocalization to verify correct subcellular targeting

These controls help distinguish VMA11-specific effects from general perturbations of cellular physiology or technical artifacts. Similar control strategies have been employed in studies of other recombinant proteins expressed in K. lactis , though adapted for the specific challenges of membrane protein expression and V-ATPase function analysis.

How can recombinant K. lactis VMA11 be leveraged for structural biology studies of V-ATPase complexes?

Recombinant K. lactis VMA11 offers several advantages for structural biology studies:

  • Cryo-EM Analysis:

    • K. lactis V-ATPase containing recombinant VMA11 can be purified for single-particle cryo-EM studies

    • VMA11 can be modified with specific tags for improved particle orientation determination

    • Site-directed mutations can probe structural dynamics during catalytic cycle

  • X-ray Crystallography Applications:

    • Recombinant VMA11 expression can be optimized for crystallization trials

    • Systematic mutagenesis guided by computational analysis can identify constructs with improved crystallization properties

    • Co-crystallization with specific inhibitors can provide insights into binding sites

  • Hybrid Structural Approaches:

    • Integrating hydrogen-deuterium exchange mass spectrometry (HDX-MS) with cryo-EM

    • Combining cross-linking mass spectrometry (XL-MS) with molecular modeling

    • Using solid-state NMR to study specific labeled residues in membrane environment

  • Structural Dynamics:

    • Time-resolved cryo-EM to capture different conformational states

    • FRET-based approaches to monitor conformational changes during catalytic cycle

    • Molecular dynamics simulations validated by experimental data

The development of improved protocols for membrane protein expression in K. lactis, as has been done for other recombinant proteins , would significantly advance structural biology applications. The respiratory preference of K. lactis may offer advantages for expressing membrane proteins like VMA11 compared to fermentative yeasts .

What are the potential applications of engineered K. lactis VMA11 variants in studying pH-dependent cellular processes?

Engineered K. lactis VMA11 variants offer powerful tools for investigating pH-dependent cellular processes:

  • pH Sensor Development:

    • Creating VMA11 variants with altered pH sensitivity to fine-tune vacuolar acidification

    • Developing strains with precisely controlled organellar pH for studying pH-dependent processes

    • Engineering pH-responsive regulatory circuits based on VMA11 function

  • Disease Model Applications:

    • Modeling human diseases associated with V-ATPase dysfunction

    • Creating platforms for screening potential therapeutics targeting V-ATPase function

    • Investigating cellular responses to pH dysregulation

  • Metabolic Engineering:

    • Manipulating intracellular pH to optimize production of pH-sensitive compounds

    • Engineering strains with altered pH homeostasis for specialized fermentation processes

    • Studying the relationship between pH gradients and cellular energy dynamics

  • Stress Response Investigations:

    • Creating VMA11 variants to study connections between pH regulation and oxidative stress responses

    • Investigating how V-ATPase function interfaces with the distinct stress response mechanisms in K. lactis

    • Examining the impact of pH dysregulation on protein folding and quality control

The food-grade status of K. lactis combined with its distinct metabolic and stress response characteristics compared to S. cerevisiae make it particularly valuable for these applications, potentially offering insights not readily obtainable in other model systems.

How might cross-disciplinary approaches enhance our understanding of recombinant K. lactis VMA11 function and applications?

Cross-disciplinary approaches can significantly advance VMA11 research:

  • Systems Biology Integration:

    • Multi-omics analysis (transcriptomics, proteomics, metabolomics) of K. lactis expressing recombinant VMA11 variants

    • Flux balance analysis to understand metabolic impacts of V-ATPase dysfunction

    • Network modeling to identify regulatory connections between V-ATPase activity and other cellular systems

  • Synthetic Biology Applications:

    • Developing synthetic regulatory circuits controlled by organellar pH

    • Creating modular expression systems for optimal membrane protein production in K. lactis

    • Engineering biosensors based on VMA11 conformational changes

  • Advanced Microscopy Techniques:

    • Super-resolution microscopy to visualize V-ATPase distribution and dynamics

    • Correlative light and electron microscopy (CLEM) to connect function with ultrastructure

    • Live-cell imaging with pH-sensitive probes to monitor V-ATPase activity in real-time

  • Computational Biology Approaches:

    • Machine learning to predict VMA11 variants with desired properties

    • Molecular simulations of the entire V-ATPase complex in membrane environments

    • Quantum mechanical calculations to understand proton translocation mechanisms

  • Evolutionary Biology Perspectives:

    • Comparative analysis of V-ATPase subunits across yeast species with different metabolic strategies

    • Investigating how the distinct evolutionary history of K. lactis (without whole genome duplication) shaped V-ATPase function

These interdisciplinary approaches build upon established methodologies for recombinant protein expression in K. lactis and can leverage the unique metabolic and stress response characteristics of this yeast to develop novel research tools and applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.