Recombinant Kocuria rhizophila ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Introduction to ATP Synthase and Subunit b (atpF)

ATP synthase, also known as F1FO ATPase, is an essential enzyme that produces ATP (adenosine triphosphate) from ADP (adenosine diphosphate) using a proton or sodium gradient . It consists of two main structural domains: F1, which contains the extramembraneous catalytic core, and F0, which contains the membrane proton channel . These domains are linked by a central stalk and a peripheral stalk . Subunit b (atpF) is a component of the F0 domain .

Kocuria rhizophila: A Brief Overview

Kocuria rhizophila is a bacterium known for its diverse metabolic capabilities . Genomic analysis reveals its ability to synthesize amino acids like serine, cysteine, and aspartate, which can then be used to generate other essential amino acids such as valine and leucine .

Recombinant ATP Synthase Subunit b (atpF)

Recombinant ATP synthase subunit b (atpF) refers to the protein produced through recombinant DNA technology . This involves introducing the gene encoding the atpF subunit into a host organism (e.g., E. coli) and expressing it to produce the protein . The recombinant protein can then be isolated and purified for various research and industrial applications .

Recombinant Production: The process typically involves the following steps:

  1. Gene Cloning: The atpF gene from a source organism (Kocuria rhizophila) is isolated and cloned into a plasmid vector.

  2. Transformation: The plasmid is introduced into a host organism (E. coli).

  3. Expression: The host organism is cultured under conditions that promote expression of the atpF gene, leading to the production of the ATP synthase subunit b protein.

  4. Purification: The recombinant protein is then purified using techniques such as affinity chromatography, exploiting tags like His-tag fused to the protein .

Functional Significance and Research Applications

ATP synthase and its subunits, including subunit b (atpF), are critical for energy production in cells . Variations in subunit structures and functions can impact the efficiency and regulation of ATP synthesis .

Research Applications:

  • Structural Studies: Recombinant atpF can be used to determine the structure and function of the ATP synthase complex .

  • Drug Discovery: The ATP synthase enzyme is a target for several drugs, including TMC207, which binds to subunit c and inhibits ATP synthesis in Mycobacterium tuberculosis .

  • Metabolic Engineering: Understanding the role of atpF in ATP synthesis can help in metabolic engineering to enhance ATP production in various organisms .

Available Recombinant atpF Products

FeatureDescription
Product OverviewRecombinant Full Length Leptospira biflexa serovar Patoc ATP synthase subunit b(atpF) Protein (B0SLC4) (1-174aa), fused to N-terminal His tag, was expressed in E. coli .
SpeciesLeptospira biflexa serovar Patoc
SourceE. coli
TagHis
Protein LengthFull Length (1-174)
Amino Acid SequenceMVLLAASGFNLLKVNPGLVIWTLVTFSVVVFVLKKFAWDKILHALEERASGIQGDINKAESLRVEAEKSLKEYKDQLFKATEEAHRIVDEAKKDAVALRTKLTEEAHNEVKGIKDSAVREIELAKGRALSEIQNQIVEMSVLIASEILEKQLKKEDYASFVEKEIAKLDKLKIK
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles .
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃ .
Gene NameatpF
SynonymsatpF; LEPBI_I0803; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
UniProt IDB0SLC4

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
atpF; KRH_09800; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-178
Protein Length
full length protein
Species
Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201)
Target Names
atpF
Target Protein Sequence
MLAAEEANPLIPDVWEMLITGIGFVILLFIAIKYIVPAFEKVFKDRADAIEGGLAKAKAA QAEAKAARDEYNQQLESARLEAQKIREEARSEGEKILADFKDRANMESARITENAHKAIE AERAAAVVSLRDEVGTLATQLASKIVGESLNDDDRANRVVDRFLADLDAEQGRTGAAR
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 catalytic core (extramembranous) and the F0 membrane proton channel. These domains are linked by a central and a peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled, via a rotary mechanism of the central stalk subunits, to proton translocation. This protein is a component of the F0 channel, forming part of the peripheral stalk which connects F1 and F0.

Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.