Recombinant Kocuria rhizophila Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

Expression and Purification

The production process involves:

  • Expression System: E. coli .

  • Tag: N-terminal His tag for immobilized metal affinity chromatography (IMAC) .

  • Form: Lyophilized powder or liquid in Tris/PBS-based buffer with 6% trehalose or 50% glycerol .

  • Yield: Typically 0.1–1.0 mg/mL after reconstitution .

Research Applications

Recombinant HtpX homolog is utilized in:

  • Enzyme Activity Studies: Investigation of metalloprotease mechanisms and substrate specificity .

  • Biochemical Assays: ELISA, Western blotting, and protein-protein interaction studies .

  • Structural Biology: Crystallization trials and domain mapping .

Key Findings from Studies

  • Thermostability: Retains activity after lyophilization and reconstitution, critical for experimental reproducibility .

  • Salt Tolerance: Compatible with high-salt buffers, aligning with K. rhizophila's halotolerant nature .

  • Industrial Potential: Homologs of HtpX in related bacteria are implicated in stress response, suggesting applications in biotechnology for protein turnover under harsh conditions .

Comparative Analysis with Homologs

FeatureK. rhizophila HtpXGeobacter uraniireducens HtpXActinobacillus pleuropneumoniae HtpX
Length (aa)301285289
Expression HostE. coliE. coliE. coli
TagHisHisHis
Purity>90%>90%>90%
Key ApplicationsProtease studiesStress response researchPathogen virulence studies

Future Directions

Current research gaps include:

  • Mechanistic Insights: Detailed kinetic studies to elucidate catalytic residues and regulatory pathways.

  • Biotechnological Optimization: Engineering thermostable variants for industrial protein degradation .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary based on purchasing method or location. For specific delivery times, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
htpX; KRH_05530; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-301
Protein Length
full length protein
Species
Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201)
Target Names
htpX
Target Protein Sequence
MHRHYNGLKTVLLLGGMWVVLLAIGWAIAGATRNSAFIMIFAVVGLLGTAYSYWNSDKLA IRSMRAVPVTPQQAPAMYRIVHELSQAAGQPMPRLFIAPTMSPNAFATGRNPEHAAVCCT EGILQLLDERELRGVLGHELMHVYNRDILTSSVAAAVAGIITSAAQMLQFAAIFGGGRGN DNRGGNPLVGLLLALLAPLAATVIQLAISRTREYDADEDGSKLTGDPLALASALRKIEGG ASQFPMDPEDQKVVNTSHLMIANPFRGGAVTGLFRTHPATADRIARLENMARAGGGNPAG R
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is HtpX protease and why is it significant in Kocuria rhizophila?

HtpX protease is a membrane-localized proteolytic system that plays a critical role in protein quality control. While extensively characterized in organisms like Escherichia coli, the HtpX homolog in K. rhizophila likely serves similar functions in stress response and protein degradation. K. rhizophila has gained attention as a potential starter culture for fermented meat products due to its desirable attributes, including protease activity . The HtpX protease homolog may contribute to the organism's proteolytic capabilities, which are important for flavor development in fermentation processes.

In E. coli, HtpX expresses a 32-kDa protein from a monocistronic transcript and is part of the heat shock regulon, with expression induced by temperature upshift . Cells overexpressing a truncated form of the HtpX protein display higher rates of degradation of puromycyl peptides, suggesting a role in eliminating aberrant proteins . Similar functions may exist in the K. rhizophila homolog, though specific characterization is needed.

How can I identify and characterize the htpX gene in K. rhizophila isolates?

Identification and characterization of the htpX gene in K. rhizophila can be approached through several methodological steps:

  • Genomic analysis: Utilize published genome sequences of K. rhizophila to identify the htpX homolog through sequence similarity with known htpX genes from model organisms like E. coli .

  • PCR amplification: Design primers based on conserved regions of htpX genes to amplify the target from K. rhizophila genomic DNA.

  • Sequence analysis: Confirm the identity through phylogenetic analysis and comparison with reference sequences, as demonstrated in taxonomic identification protocols for K. rhizophila isolates .

  • Expression analysis: Examine expression patterns under different stress conditions, particularly heat shock, as htpX is known to be part of the heat shock regulon in other bacteria .

  • Functional characterization: Analyze the genomic context of htpX in K. rhizophila to identify potential co-regulated genes, which may provide insights into its functional role .

What are the optimal conditions for expression of recombinant K. rhizophila HtpX protease?

Based on knowledge of HtpX in other bacterial systems, optimal expression conditions for recombinant K. rhizophila HtpX may include:

  • Induction parameters: Since htpX is typically heat-inducible in bacteria like E. coli, temperature upshift protocols (e.g., from 30°C to 42°C) may enhance expression .

  • Expression systems: While E. coli is commonly used for heterologous expression, consider alternative hosts that may better accommodate the membrane-associated nature of HtpX.

  • Growth media optimization: For K. rhizophila cultivation, media compositions supporting protease production should be evaluated, as the organism has demonstrated varied physiological properties even within the species .

  • Expression vectors: Consider vectors with strong, inducible promoters that function well with membrane proteins, potentially including fusion tags that facilitate purification without compromising activity.

  • Solubilization strategies: As a membrane-bound protease, HtpX may require detergent optimization for extraction and purification while maintaining functional integrity.

How do you assess the proteolytic activity of recombinant K. rhizophila HtpX?

Assessment of proteolytic activity for recombinant K. rhizophila HtpX should consider its membrane-associated nature and potential substrate specificity:

  • Proteolytic assays: Utilize synthetic peptide substrates containing HtpX recognition motifs, or monitor degradation of puromycyl peptides, which have been shown to be processed more rapidly in cells overexpressing htpX .

  • In vivo activity: Construct deletion mutants (ΔhtpX) in K. rhizophila and evaluate phenotypic changes under stress conditions, similar to methodologies employed for other bacterial proteases .

  • Complementation studies: Verify functionality by complementing htpX-deficient strains with the cloned gene, assessing restoration of wild-type phenotypes .

  • Substrate identification: Employ proteomic approaches to identify natural substrates of HtpX in K. rhizophila, particularly focusing on membrane proteins that accumulate in htpX-deficient strains.

  • Activity optimization: Evaluate the effects of temperature, pH, and ion concentrations on HtpX activity, considering K. rhizophila's natural environmental adaptations.

How does the K. rhizophila HtpX homolog compare structurally and functionally to HtpX in other bacterial species?

Comparative analysis of the K. rhizophila HtpX homolog with well-characterized HtpX proteases reveals insights into its potential structure-function relationships:

  • Sequence conservation: Multiple sequence alignment reveals conserved catalytic domains and transmembrane regions, with potential species-specific variations reflecting evolutionary adaptation to different environmental niches.

  • Structural predictions: While no crystal structure exists for K. rhizophila HtpX, homology modeling based on related proteases suggests a membrane-spanning topology with cytoplasmic and periplasmic domains.

  • Functional divergence: Unlike the HtpX in S. maltophilia, which contributes significantly to aminoglycoside resistance , the K. rhizophila homolog may have evolved functions more relevant to its role as a saprophytic soil bacterium or in food fermentation processes.

  • Domain architecture: Analysis of conserved domains may reveal unique features of the K. rhizophila HtpX, particularly in substrate recognition regions that could reflect its specific physiological role.

  • Regulatory mechanisms: Examination of the promoter region of K. rhizophila htpX might reveal whether it shares the sigma 32-dependent regulation observed in E. coli or has developed alternative regulatory mechanisms.

What role might the HtpX protease play in K. rhizophila's adaptation to fermentation environments?

The potential role of HtpX in K. rhizophila's adaptation to fermentation environments can be investigated through several approaches:

  • Expression profiling: Quantitative RT-PCR analysis of htpX expression under various fermentation conditions (pH shifts, salt concentrations, temperature changes) would indicate environmental triggers for protease activation.

  • Proteome analysis: Comparative proteomics of wild-type versus htpX-deficient K. rhizophila strains during fermentation could identify substrates and pathways affected by HtpX activity.

  • Contribution to flavor development: Since K. rhizophila has been identified as having desirable attributes for meat fermentation , the specific contribution of HtpX to proteolysis of meat proteins and subsequent amino acid profile modifications could be evaluated.

  • Stress response integration: HtpX may participate in coordinated stress responses during fermentation, potentially interacting with other quality control systems to maintain cellular homeostasis under challenging conditions.

  • Interspecies interactions: In mixed culture fermentations, HtpX activity might influence K. rhizophila's interactions with other microorganisms through altered surface proteins or secreted factors.

How can CRISPR-Cas9 gene editing be optimized for studying htpX function in K. rhizophila?

CRISPR-Cas9 gene editing for studying htpX function in K. rhizophila requires specific optimization strategies:

  • Delivery methods: Electroporation protocols need adjustment for K. rhizophila's cell wall characteristics, with parameters optimized for transformation efficiency.

  • Guide RNA design: Target sequence selection should account for the GC content of K. rhizophila's genome, avoiding potential off-target sites.

  • Homology-directed repair templates: For precise editing, design repair templates with homology arms of sufficient length (typically 1-2 kb) flanking the desired modification in the htpX gene.

  • Screening strategies: Develop efficient screening methods to identify successful transformants, potentially using phenotypic markers associated with htpX function or PCR-based genotyping.

  • Validation approaches: Confirm edits through sequencing and functional assays, verifying that the CRISPR-modified strain exhibits expected phenotypic changes in proteolytic activity.

What biochemical mechanisms explain the potential role of K. rhizophila HtpX in aminoglycoside resistance?

While direct evidence for K. rhizophila HtpX's role in aminoglycoside resistance is limited, insights can be drawn from studies of HtpX in other bacteria:

  • Membrane integrity maintenance: As a membrane-bound protease, HtpX may contribute to membrane homeostasis by degrading damaged membrane proteins, potentially reducing aminoglycoside uptake.

  • Protein quality control: Based on findings in S. maltophilia, HtpX likely contributes to eliminating misfolded proteins that accumulate due to aminoglycoside-induced mistranslation .

  • Coordinated resistance mechanisms: HtpX may work synergistically with other resistance determinants, such as efflux pumps, as observed in the interaction between HtpX and the SmeYZ efflux system in S. maltophilia .

  • Adaptive response regulation: The protease might regulate expression of other resistance factors through selective degradation of regulatory proteins or membrane-bound sensors.

  • Stress response integration: HtpX could participate in broader stress response networks that are activated following aminoglycoside exposure, contributing to adaptive resistance development.

What are the most effective methods for purifying recombinant K. rhizophila HtpX while maintaining its activity?

Purification of membrane-bound HtpX presents unique challenges that require specialized approaches:

  • Membrane extraction optimization: Systematic testing of detergents (non-ionic, zwitterionic, and mild ionic) at various concentrations is essential for efficient solubilization without denaturation.

  • Affinity chromatography: Design expression constructs with appropriate tags (His6, FLAG, or Strep-tag II) positioned to avoid interference with catalytic domains or membrane insertion.

  • Size exclusion chromatography: Optimize buffer compositions containing stabilizing agents and appropriate detergent concentrations to maintain the native oligomeric state during purification.

  • Activity preservation: Include protease inhibitor cocktails (excluding those affecting metalloproteases if HtpX is metal-dependent) during early purification steps to prevent autodegradation.

  • Storage conditions: Evaluate various buffer compositions, glycerol concentrations, and storage temperatures to maintain long-term stability and activity of the purified enzyme.

How can transcriptomic analysis be designed to understand htpX regulation in K. rhizophila under different stress conditions?

A comprehensive transcriptomic analysis of htpX regulation requires careful experimental design:

  • Stress conditions selection: Include heat shock (based on E. coli htpX induction ), oxidative stress, membrane-disrupting agents, and aminoglycosides (based on S. maltophilia studies ).

  • Time-course sampling: Collect samples at multiple time points (immediate, short-term, and long-term exposure) to capture the dynamics of htpX regulation.

  • RNA extraction optimization: Develop protocols specifically optimized for K. rhizophila to ensure high-quality RNA yield, particularly important for detecting potentially low-abundance htpX transcripts.

  • Quantification methods: Employ both RNA-seq for global expression patterns and targeted qRT-PCR for validation and precise quantification of htpX transcripts.

  • Data analysis pipeline: Include analysis of co-regulated genes to identify potential operons or regulons that include htpX, providing insights into its functional networks .

What experimental approaches can determine if K. rhizophila HtpX contributes to flavor development in fermented meat products?

To establish the connection between HtpX activity and flavor development in fermented meats, consider these approaches:

  • Comparative fermentation trials: Inoculate meat models with wild-type K. rhizophila versus htpX deletion mutants, followed by comprehensive sensory evaluation and chemical analysis.

  • Amino acid profiling: Quantify free amino acids in fermented products, as enhanced proteolysis by HtpX might modify the amino acid profile and subsequently influence flavor development .

  • Volatile compound analysis: Employ gas chromatography-mass spectrometry to identify volatile compounds derived from amino acid catabolism that contribute to aroma, comparing products fermented with different K. rhizophila strains.

  • Substrate specificity assays: Evaluate HtpX activity against specific meat proteins to identify preferential substrates that might yield flavor-active peptides or amino acids.

  • In situ expression analysis: Monitor htpX expression during actual meat fermentation using RT-PCR or reporter gene constructs to correlate expression patterns with flavor development stages.

What are common challenges in expressing recombinant K. rhizophila HtpX and how can they be addressed?

Recombinant expression of membrane proteases like HtpX presents several challenges with specific solutions:

  • Toxicity issues: If HtpX overexpression is toxic to host cells, employ tightly regulated inducible systems with optimized induction conditions to balance expression and cell viability.

  • Inclusion body formation: In cases of insoluble protein aggregation, consider lower expression temperatures (16-20°C), co-expression with chaperones, or fusion partners that enhance solubility.

  • Membrane insertion problems: Ensure proper targeting to membranes by preserving native signal sequences or employing host-appropriate signal peptides, and consider using membrane protein-specialized expression hosts.

  • Protein misfolding: Optimize expression conditions including media composition, temperature shifts during growth, and selective pressure maintenance for expression plasmids.

  • Low yield: Implement scale-up strategies including high-density fermentation techniques and optimized induction timing based on growth phase monitoring.

How can researchers distinguish between direct and indirect effects when studying HtpX function in K. rhizophila?

Distinguishing direct from indirect effects in HtpX functional studies requires multiple complementary approaches:

  • Catalytic site mutations: Generate variants with mutations in predicted catalytic residues to separate proteolytic activity from potential structural or regulatory roles.

  • Substrate trapping: Employ activity-dead mutants that can still bind but not cleave substrates to identify direct interaction partners.

  • In vitro verification: Confirm direct proteolytic activity on candidate substrates using purified recombinant HtpX in reconstituted membrane systems.

  • Temporal analysis: Track the sequence of cellular events following HtpX activation or inactivation to differentiate primary from secondary effects.

  • Comprehensive controls: Include appropriate control strains, such as catalytically inactive HtpX expressed at similar levels to wild-type protein, to control for expression-related artifacts.

What analytical techniques are most suitable for studying the membrane topology and structure of K. rhizophila HtpX?

Determining membrane topology and structure of HtpX requires specialized techniques:

  • Cysteine accessibility methods: Introduce cysteine residues at various positions throughout HtpX and assess their accessibility to membrane-impermeable sulfhydryl reagents to map transmembrane topology.

  • Protease protection assays: Expose membrane vesicles containing HtpX to proteases, followed by mass spectrometry analysis of protected fragments to determine membrane-embedded regions.

  • Fluorescence spectroscopy: Employ site-specific fluorescent labeling combined with quenching studies to determine the orientation and depth of specific residues within the membrane.

  • Cryo-electron microscopy: For high-resolution structural analysis, purify HtpX in appropriate detergent micelles or nanodiscs for single-particle cryo-EM studies.

  • Molecular dynamics simulations: Complement experimental data with computational modeling of HtpX in a lipid bilayer to predict dynamic structural features.

How might synthetic biology approaches be applied to engineer K. rhizophila HtpX for enhanced functionality in biotechnological applications?

Synthetic biology offers several avenues for enhancing HtpX functionality:

  • Substrate specificity engineering: Modify the substrate-binding pocket through targeted mutations to enhance activity toward specific proteins relevant to particular applications.

  • Stability enhancement: Introduce stabilizing mutations identified through directed evolution or computational prediction to improve tolerance to industrial processing conditions.

  • Regulatory circuit design: Develop synthetic regulatory systems to control HtpX expression in response to specific environmental cues relevant to industrial processes.

  • Domain swapping: Create chimeric proteases combining functional domains from HtpX homologs across species to generate novel activities or substrate preferences.

  • Immobilization strategies: Design modified versions of HtpX amenable to surface display or direct immobilization while maintaining catalytic activity, enabling reusable enzymatic systems.

What potential applications exist for recombinant K. rhizophila HtpX beyond traditional food fermentation?

The unique properties of K. rhizophila HtpX suggest several novel applications:

  • Bioremediation: Explore HtpX's potential to degrade recalcitrant peptide-containing environmental contaminants, particularly in challenging environments where K. rhizophila's adaptability could be advantageous.

  • Pharmaceutical applications: Investigate HtpX's capability for specific proteolytic modifications of therapeutic peptides or proteins, potentially creating novel bioactive compounds.

  • Diagnostic tools: Develop HtpX-based biosensors for detecting specific protein targets by coupling proteolytic activity to signal generation systems.

  • Antimicrobial resistance research: Given HtpX's potential role in aminoglycoside resistance , explore its use as a target for novel adjuvant therapies that could restore antibiotic sensitivity.

  • Protein engineering tools: Utilize HtpX's membrane protein degradation capability as a tool for studying membrane protein topology or for controlled degradation in synthetic biology circuits.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.