Recombinant Kocuria rhizophila Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Enzymatic Function and Mechanism

uppP operates in the undecaprenyl phosphate biosynthesis pathway:

  1. Reaction: Hydrolyzes UPP (C55-PP) to UP (C55-P), releasing inorganic pyrophosphate .

  2. Role in Cell Wall Synthesis: UP transports lipid-linked peptidoglycan precursors across the cytoplasmic membrane .

  3. Kinetics: Mutagenesis studies on homologous enzymes highlight the importance of residues like Tyr-148 and Trp-224 for catalytic efficiency (e.g., 10–1,600-fold reductions in k<sub>cat</sub>/K<sub>m</sub> upon mutation) .

Catalytic Insights

  • Substrate Binding: Conserved aromatic residues facilitate interactions with isopentenyl diphosphate (IPP) and farnesyl diphosphate (FPP) .

  • Inhibition: Small-molecule inhibitors (e.g., UK-106051) disrupt UPP synthesis by competitively binding to the FPP/UP site, demonstrating potential as antibacterial agents .

Biotechnological Applications

  • Heterologous Expression: K. rhizophila DC2201 is engineered for biocatalysis using shuttle vectors (e.g., pKITE301), enabling high-yield production of recombinant enzymes like uppP .

  • Industrial Relevance: Solvent-tolerant Kocuria strains serve as chassis for producing enantiopure compounds (e.g., (S)-styrene oxide) in biphasic reaction systems .

Future Directions

  • Inhibitor Development: Targeting uppP could address antibiotic resistance, as UPP biosynthesis is absent in humans .

  • Structural Optimization: Engineering thermostable variants could enhance industrial utility .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Kindly consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us beforehand. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging this vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize developing it.
Synonyms
uppP; KRH_13930; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-277
Protein Length
full length protein
Species
Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201)
Target Names
uppP
Target Protein Sequence
MNWIEAIILGLVQGLTEFLPVSSSAHLRIVGEFLPHGGDPGAAFTAITQLGTETAVILFF WRDIVRIIKQWALSLTGRVDRKDPDARMGWFIILGSFPIAVLGLLLQDVIETQFRSLWIT ATMLIVFGLFLAVADHVGKQERHLEDLDVKHAVGYGFAQALALIPGVSRSGGTITAGLLM GYTRAAAARYAFLLAIPAVFSSGLYELYKVLAGKVPAGIYTMGQTAVATVIAFAVGYLII GWFMHYISERSYSLFVWYRILLGAAVFVLLGTGILTA
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the biochemical function of Kocuria rhizophila Undecaprenyl-diphosphatase (uppP)?

Kocuria rhizophila uppP (EC 3.6.1.27) functions as an integral membrane protein that catalyzes the dephosphorylation of undecaprenyl pyrophosphate to undecaprenyl phosphate, a critical carrier lipid in bacterial cell wall synthesis. This enzymatic activity is essential for recycling the lipid carrier and maintaining bacterial cell wall integrity. The enzyme contains two consensus regions with (E/Q)XXXE plus PXSRSXXT motifs that are oriented toward the periplasmic site, indicating its biological function occurs on the outer side of the plasma membrane . The dephosphorylation reaction is critical for bacterial survival as it regenerates the lipid carrier required for peptidoglycan synthesis.

How does uppP differ from Undecaprenyl pyrophosphate synthase (UPPs)?

While both enzymes participate in the same metabolic pathway, they catalyze distinct reactions:

FeatureUndecaprenyl-diphosphatase (uppP)Undecaprenyl pyrophosphate synthase (UPPs)
Catalytic functionDephosphorylates undecaprenyl pyrophosphateCatalyzes condensation of IPP onto FPP to produce UPP
Reaction typeHydrolysisConsecutive condensations
Cellular locationIntegral membrane proteinSoluble/peripheral membrane protein
Alternative namesBacitracin resistance proteinDi-trans,poly-cis-decaprenylcistransferase
EC number3.6.1.272.5.1.31
Key structural motifs(E/Q)XXXE plus PXSRSXXTAspartate-rich motifs

UPPs catalyzes the consecutive condensations of isopentenyl pyrophosphate (IPP) groups onto trans-farnesyl pyrophosphate (FPP) to produce the C55 isoprenoid undecaprenyl pyrophosphate (UPP) , while uppP subsequently dephosphorylates this product to enable recycling in the bacterial cell wall synthesis pathway .

What are the optimal storage conditions for recombinant K. rhizophila uppP?

For recombinant K. rhizophila uppP, optimal storage conditions are:

  • Short-term storage (up to one week): 4°C in working aliquots

  • Long-term storage: -20°C or -80°C for extended preservation

  • Storage buffer: Tris-based buffer with 50% glycerol, optimized for protein stability

  • Handling: Repeated freezing and thawing is not recommended as it significantly reduces enzyme activity

When preparing aliquots, it's advisable to use volumes appropriate for single experiments to minimize freeze-thaw cycles. The presence of 50% glycerol in the storage buffer helps maintain enzyme stability during freezing by preventing ice crystal formation that can disrupt protein structure.

What structural features of uppP are critical for its enzymatic activity?

Site-directed mutagenesis studies have identified several key residues essential for uppP activity:

  • Conserved histidine residue (His-30): Located near the aqueous interface and oriented toward the periplasmic site. The H30A mutant exhibits severely impaired enzyme activity, suggesting its critical role in catalysis .

  • Arginine-174: Forms hydrogen bonds with the hydroxyl group of the pyrophosphate moiety. The R174A mutant is completely inactive, demonstrating this residue's essential role in substrate binding and/or catalysis .

  • Two consensus regions: The (E/Q)XXXE motif and PXSRSXXT motif together form the active site of uppP. The proximity of these regions to the aqueous interface suggests they create a pocket accessible to the pyrophosphate moiety of the substrate .

  • Transmembrane topology: The proper orientation of the enzyme within the membrane is critical for accessing its substrate. The active site appears to be positioned to interact with the pyrophosphate group while the undecaprenyl chain remains embedded in the membrane .

Mutation of these key residues provides valuable insights into the catalytic mechanism and could inform the design of specific inhibitors targeting uppP activity.

How do environmental conditions affect recombinant K. rhizophila uppP activity?

Recombinant K. rhizophila uppP activity is influenced by several environmental factors:

FactorOptimal RangeEffect on ActivityExperimental Consideration
pH5.7-7.5Maximum activity at neutral pH; significant decrease outside this rangeBuffer selection is critical; phosphate or Tris buffers at physiological pH are recommended
Temperature10-40°CActivity increases with temperature up to ~37°C, then decreasesAssays typically conducted at 30-37°C; K. rhizophila is mesophilic
Salt concentrationTolerates up to 15% (w/v) NaClHigh salt can enhance stability but may affect kineticsSalt concentration should be optimized for specific assay conditions
DetergentDepends on detergent typeNecessary for solubilization but can inhibit at high concentrationsMild detergents like DDM at concentrations just above CMC are recommended

The integral membrane nature of uppP necessitates careful consideration of these factors in experimental design. For in vitro activity assays, the choice of detergent is particularly critical as it must maintain the protein in a soluble, correctly folded state while allowing substrate access to the active site .

What approaches can be used to study inhibition mechanisms of uppP?

Studying inhibition mechanisms of uppP requires multifaceted approaches:

  • Biochemical assays: Measure dephosphorylation activity using synthetic substrates in the presence of potential inhibitors. Kinetic parameters (IC50, Ki) can be determined through Michaelis-Menten analysis.

  • Biophysical methods:

    • Surface Plasmon Resonance (SPR) to measure binding kinetics (kon and koff rates)

    • Isothermal Titration Calorimetry (ITC) to determine thermodynamic parameters

    • Differential Scanning Fluorimetry (DSF) to assess thermal stability changes upon inhibitor binding

  • Structural studies: Co-crystallization with inhibitors or substrate analogs can reveal binding modes. For membrane proteins like uppP, this typically requires:

    • Detergent solubilization and purification

    • Lipidic cubic phase crystallization methods

    • Cryo-electron microscopy as an alternative approach

  • Computational approaches:

    • Molecular docking to predict inhibitor binding poses

    • Molecular dynamics simulations to understand conformational changes

    • Virtual screening to identify novel inhibitor candidates

Understanding allosteric inhibition mechanisms, similar to those observed for UPPs with compounds like UK-106051, could provide valuable insights. For UPPs, the presence of FPP alters inhibitor binding kinetics, resulting in a 25-fold increase in binding affinity (KD 6.6 ± 0.7 × 10−8 M with FPP vs. KD 1.7 ± 0.3 × 10−6 M without) . Similar cooperative binding mechanisms may exist for uppP inhibitors.

What expression systems are most effective for producing recombinant K. rhizophila uppP?

Given the membrane-bound nature of uppP, selecting an appropriate expression system is critical:

  • E. coli-based expression systems:

    • pET vector systems: High expression levels but may lead to inclusion body formation

    • C41/C43 strains: Engineered for membrane protein expression with reduced toxicity

    • Fusion tags: bacteriorhodopsin tag has been successfully used for expression of similar membrane proteins

    • Induction conditions: Lower temperatures (16-25°C) and reduced inducer concentrations often improve soluble expression

  • Cell-free expression systems:

    • Allow direct incorporation into liposomes or nanodiscs

    • Eliminate toxicity issues associated with membrane protein overexpression

    • Enable controlled addition of detergents or lipids

  • Yeast expression systems:

    • Pichia pastoris provides eukaryotic machinery with high expression levels

    • Natural membrane insertion machinery may improve folding

For uppP specifically, a solution expression system has been successfully employed for the related undecaprenyl diphosphate synthase in E. coli, achieving near homogeneity in purification . The addition of a bacteriorhodopsin tag at the N-terminus has improved expression of similar membrane proteins .

What purification strategies are recommended for obtaining high-purity recombinant uppP?

Purification of membrane proteins like uppP requires specialized approaches:

  • Membrane extraction and solubilization:

    • Isolate membrane fraction through differential centrifugation

    • Solubilize using mild detergents (DDM, LMNG, or CHAPS)

    • Optimize detergent:protein ratio to prevent aggregation

  • Chromatography sequence:

    • Immobilized Metal Affinity Chromatography (IMAC): Initial capture using His-tag

    • Ion Exchange Chromatography: Further purification based on charge differences

    • Size Exclusion Chromatography: Final polishing step and buffer exchange

  • Quality assessment:

    • SDS-PAGE and Western blotting for purity and identity confirmation

    • Mass spectrometry for accurate molecular weight determination

    • Dynamic Light Scattering to verify monodispersity

    • Circular Dichroism to assess secondary structure

For related enzymes, a multi-step chromatography approach has been effective, including TSK-DEAE, ceramic hydroxyapatite, TSK-ether, Superdex 200, and heparin-Actigel chromatography . Throughout purification, maintaining an appropriate detergent concentration above the critical micelle concentration is essential to prevent protein aggregation.

How can researchers assess the enzymatic activity of purified recombinant uppP?

Several complementary methods can be used to assess uppP activity:

When designing activity assays, researchers should consider:

  • Buffer composition (pH, ionic strength)

  • Detergent type and concentration

  • Divalent cation requirements (Mg2+, Mn2+)

  • Temperature and incubation time

  • Substrate concentration and solubility

What approaches can be used to investigate structure-function relationships in K. rhizophila uppP?

Investigating structure-function relationships in membrane proteins like uppP requires integrated approaches:

  • Computational structure prediction:

    • Homology modeling based on related structures

    • Ab initio modeling using Rosetta membrane protocols

    • Molecular dynamics simulations to study conformational dynamics

  • Site-directed mutagenesis:

    • Targeting conserved residues identified through sequence alignment

    • Systematic mutation of predicted active site residues

    • Creation of chimeric proteins to identify functional domains

  • Biophysical characterization:

    • Thermostability analysis through differential scanning calorimetry

    • Conformational changes monitored by intrinsic fluorescence

    • Binding studies using isothermal titration calorimetry

  • Structural biology techniques:

    • X-ray crystallography (challenging for membrane proteins)

    • Cryo-electron microscopy for high-resolution structure determination

    • Hydrogen-deuterium exchange mass spectrometry to probe solvent accessibility

  • Functional correlation:

    • Kinetic analysis of mutants to determine effects on catalytic parameters

    • Inhibitor binding studies to identify interaction sites

    • In vivo complementation studies to assess functional relevance

For uppP specifically, a two-dimensional structure prediction has shown that consensus regions containing (E/Q)XXXE plus PXSRSXXT motifs and a histidine residue are localized near the aqueous interface and oriented toward the periplasmic site . This provides a starting point for further investigation of the active site architecture and catalytic mechanism.

How can uppP be exploited as an antimicrobial target?

As an essential enzyme in bacterial cell wall synthesis, uppP presents a promising antimicrobial target:

  • Rational inhibitor design:

    • Structure-based design targeting the active site

    • Allosteric inhibitors that disrupt enzyme dynamics

    • Peptidomimetics based on known inhibitors like bacitracin

  • Screening approaches:

    • High-throughput screening of chemical libraries

    • Fragment-based drug discovery

    • Natural product screening focusing on compounds with known cell wall effects

  • Combination therapy strategies:

    • Synergy with existing cell wall-targeting antibiotics

    • Dual inhibition of uppP and related enzymes like UPPs

    • Membrane permeabilizers to enhance inhibitor access

  • Species selectivity considerations:

    • Exploiting structural differences between bacterial species

    • Targeting K. rhizophila-specific features for selective applications

    • Broad-spectrum vs. narrow-spectrum inhibitor development

UPPs inhibition has demonstrated a cidal mechanism with more than three log units of reduction in viable bacterial counts observed at 24 hours , suggesting that targeting this pathway is a viable antimicrobial strategy. Similar effects might be expected for uppP inhibition.

What are the implications of uppP research for understanding bacterial resistance mechanisms?

Understanding uppP can provide insights into bacterial resistance mechanisms:

  • Bacitracin resistance: uppP is alternatively named "Bacitracin resistance protein" as it plays a role in resistance to this antibiotic . Increased expression or mutations in uppP can confer resistance by:

    • Increasing the rate of undecaprenyl pyrophosphate recycling

    • Altering the binding site for bacitracin

    • Changing the membrane localization of the enzyme

  • Cross-resistance patterns: Modifications in uppP may affect susceptibility to other cell wall-targeting antibiotics through:

    • Altered peptidoglycan synthesis rates

    • Changes in cell wall composition

    • Modified membrane permeability

  • Horizontal gene transfer: Acquisition of variant uppP genes might contribute to resistance spread among bacterial populations.

  • Compensatory mutations: Bacteria might develop alternative pathways or regulatory mechanisms to compensate for reduced uppP function under selective pressure.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.