Recombinant Kogia breviceps NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Kogia breviceps NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L) is a genetically engineered protein derived from the mitochondrial genome of the pygmy sperm whale (Kogia breviceps). It corresponds to the MT-ND4L gene, which encodes a subunit of Complex I (NADH dehydrogenase) in the electron transport chain . This enzyme facilitates the transfer of electrons from NADH to ubiquinone, generating a proton gradient critical for ATP synthesis via oxidative phosphorylation .

Protein Structure

The MT-ND4L protein comprises 98 amino acids (11 kDa) and is hydrophobic, forming part of the transmembrane domain of Complex I . Key features:

ParameterDetail
Gene OverlapOverlaps with MT-ND4 gene by 7 nucleotides (shared codons for Gln, Cys, Stop)
Subcellular LocationMitochondrial inner membrane (embedded in lipid bilayer)
Functional RoleCore subunit in proton translocation and electron transfer

Catalytic Function

MT-ND4L participates in:

  1. Electron Transfer: Facilitates NADH → FMNH₂ → Fe-S clusters → ubiquinone pathway .

  2. Proton Pumping: Conformational changes during electron transfer drive H⁺ extrusion, creating a proton gradient .

Recombinant Production

ParameterDetail
Expression SystemE. coli (recombinant expression)
TaggingN-terminal His-tag for purification
Purity>90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer (pH 8.0, 6% trehalose)

Research and Diagnostic Tools

  • ELISA Kits: Available for quantification in clinical/academic studies (e.g., Creative Biomart, CUSABIO) .

  • Functional Studies: Used to investigate mitochondrial dysfunction, particularly in Leber’s Hereditary Optic Neuropathy (LHON) .

Genetic Mutations and Disease

MutationClinical Impact
T10663C (Val65Ala)Causes LHON; disrupts Complex I activity, impairing ATP production
ND4L PolymorphismsLinked to increased BMI, obesity, and metabolic disorders

Mechanisms in LHON

The Val65Ala mutation disrupts Complex I assembly, leading to:

  • Mitochondrial Dysfunction: Reduced electron transport efficiency .

  • Tissue-Specific Damage: Optic nerve degeneration due to high energy demands and oxidative stress .

Technical Limitations

  • Protein Stability: Requires storage at -20°C/-80°C to prevent degradation .

  • Functional Replicability: Recombinant proteins may lack post-translational modifications present in native mitochondrial forms .

Research Priorities

  1. Therapeutic Development: Investigating gene therapy or small-molecule enhancers to restore Complex I function .

  2. Cetacean Comparative Studies: Exploring evolutionary adaptations in Kogia breviceps for insights into mitochondrial efficiency .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format that is currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult with your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which you can use as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Kogia breviceps (Pygmy sperm whale) (Physeter breviceps)
Target Names
Target Protein Sequence
MPLIHINIMMAFIMSLVGLLMYRSHLMSALLCLEGMMLSLFILTALLALDSHFILASMIP IILLVFAACEAAIGLALLVMISSTYGTDYVQNLNLLRC
Uniprot No.

Target Background

Function
The protein is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor.
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the function of MT-ND4L in the mitochondrial respiratory chain?

MT-ND4L serves as a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). This protein is specifically part of the enzyme membrane arm embedded in the lipid bilayer and is critically involved in proton translocation. It works in conjunction with other subunits to catalyze electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor . The protein's hydrophobicity allows it to be properly embedded within the mitochondrial inner membrane, facilitating its role in the chemiosmotic process that ultimately leads to ATP production. Understanding this function is essential for researchers investigating mitochondrial respiratory chain disorders, bioenergetics, and evolutionary aspects of mitochondrial proteins.

How is MT-ND4L involved in Complex I assembly?

MT-ND4L is one of the hydrophobic proteins translated from mitochondrial DNA that becomes integrated into the membrane arm of Complex I during the assembly process . According to the assembly pathway model described in the research, MT-ND4L likely contributes to the formation of the membrane arm subassembly. The assembly of Complex I begins with the formation of a 315 kDa subcomplex anchored to the membrane by MT-ND1. Separately, a 370 kDa subcomplex consisting of subunits of the membrane arm (which likely includes MT-ND4L) is formed. These subcomplexes join together to create a 550 kDa intermediate. Upon addition of the most distal components of the membrane arm, including MT-ND4 and MT-ND5, an 815 kDa subassembly is formed . Understanding this assembly process is crucial for researchers investigating mitochondrial disorders related to Complex I deficiencies.

What expression systems are most effective for producing recombinant Kogia breviceps MT-ND4L?

For the expression of hydrophobic mitochondrial proteins like MT-ND4L, several systems can be employed with specific modifications to address the challenges of membrane protein expression:

  • Bacterial expression systems: E. coli-based systems utilizing specialized strains (C41(DE3) or C43(DE3)) designed for membrane protein expression can be effective when optimized. Key considerations include:

    • Using fusion partners like MBP or SUMO to enhance solubility

    • Employing low induction temperatures (16-20°C)

    • Utilizing specialized detergents for extraction

  • Eukaryotic expression systems: Yeast (S. cerevisiae or P. pastoris) or insect cell systems may provide better folding environments for mitochondrial proteins.

  • Cell-free expression systems: These can be particularly useful for toxic membrane proteins and allow direct incorporation into liposomes or nanodiscs.

Researchers should optimize codon usage for the expression host and consider incorporating purification tags that can be removed without affecting the protein's native structure. Expression trials should systematically evaluate temperature, inducer concentration, and expression duration to maximize yield while maintaining protein functionality.

What purification strategies effectively isolate recombinant MT-ND4L while maintaining its structural integrity?

Purifying hydrophobic membrane proteins like MT-ND4L requires specialized approaches:

  • Detergent selection: Initial screening of mild detergents (DDM, LMNG, or digitonin) is crucial to solubilize the protein while preserving structure.

  • Purification workflow:

    • Initial capture using affinity chromatography (IMAC for His-tagged constructs)

    • Intermediate purification using ion exchange chromatography

    • Final polishing using size exclusion chromatography in detergent-containing buffers

  • Stabilization approaches:

    • Incorporation into nanodiscs or amphipols for detergent-free handling

    • Addition of lipids from the native membrane environment

Purification StepMethodBuffer ComponentsCritical Parameters
Membrane isolationDifferential centrifugation50 mM Tris-HCl pH 7.5, 150 mM NaCl, protease inhibitorsComplete cell lysis, separation from cytosolic fraction
SolubilizationDetergent extractionAbove buffer + 1% DDM/digitonin, 1 hour at 4°CDetergent:protein ratio, incubation time
Affinity purificationIMACAbove buffer + 0.05% DDM, 10-300 mM imidazole gradientFlow rate, washing steps
Size exclusionSuperdex 20020 mM HEPES pH 7.5, 150 mM NaCl, 0.02% DDMColumn equilibration, fraction collection

Throughout purification, researchers should monitor protein stability using methods such as thermal shift assays and limited proteolysis to ensure the structural integrity is maintained.

How can recombinant MT-ND4L be used to study Complex I assembly defects?

Recombinant MT-ND4L can serve as a valuable tool for investigating Complex I assembly defects through several experimental approaches:

  • Reconstitution studies: Purified recombinant MT-ND4L can be used in in vitro reconstitution experiments to assess its integration into Complex I subcomplexes. This approach allows researchers to determine the specific role of MT-ND4L in the assembly process and identify interaction partners.

  • Rescue experiments: In cell lines with MT-ND4L deficiencies or mutations, introduction of wild-type recombinant protein can help determine if assembly defects can be rescued. This is particularly relevant given the observation that mutations in Complex I components can lead to accumulation of subcomplexes of 815 kDa and 550 kDa .

  • Interaction studies: Techniques such as co-immunoprecipitation or crosslinking mass spectrometry using recombinant MT-ND4L can identify direct interaction partners during assembly. The 550 kDa subcomplex that accumulates during assembly defects represents a critical intermediate where interactions can be studied .

  • CRISPR/Cas9 replacement studies: Using gene editing to replace endogenous MT-ND4L with tagged or mutated versions can provide insights into assembly mechanisms in cellular contexts.

Researchers should utilize blue native PAGE (BN-PAGE) to monitor the formation of Complex I subcomplexes (550 kDa and 815 kDa) when studying assembly, similar to the approaches used in identifying the roles of assembly factors like NDUFAF1-4, ACAD9, ECSIT, FOXRED1, and TMEM126B .

What methods effectively assess the functional impact of MT-ND4L mutations?

To evaluate how mutations in MT-ND4L affect its function, researchers can employ several complementary approaches:

  • Oxygen consumption measurements: Measuring cellular respiration rates can quantify the functional impact of MT-ND4L mutations on Complex I activity. Techniques such as high-resolution respirometry or oxygen consumption rate (OCR) measurements can be used, followed by substrate-specific analyses (adding duroquinol to bypass Complex I) to confirm Complex I-specific defects .

  • Enzymatic activity assays: NADH:ubiquinone oxidoreductase activity assays using isolated mitochondria or purified complexes can directly measure the impact of mutations on electron transfer rates.

  • Membrane potential measurements: Using potentiometric dyes like TMRM or JC-1 to assess if mutations affect the proton translocation function of MT-ND4L.

  • Structural studies: Cryo-EM analyses of assembled complexes containing mutant MT-ND4L can identify structural aberrations that explain functional defects.

  • Phosphorylation analysis: Given that cAMP-dependent phosphorylation has been shown to modulate Complex I activity , assessing phosphorylation state changes in mutant proteins may provide mechanistic insights.

Research has shown that mutations in Complex I components can have profound effects, including abolishing cAMP-dependent activation and causing assembly defects. For example, a 5 bp duplication that destroyed a phosphorylation site in NDUFS4 abolished cAMP-dependent activation of Complex I, while a nonsense mutation leading to protein termination caused assembly defects .

How do evolutionary variations in MT-ND4L across marine mammals impact Complex I function?

Evolutionary analysis of MT-ND4L across marine mammals reveals patterns of conservation and adaptation that can provide insights into Complex I function:

  • Phylogenetic analysis: By comparing MT-ND4L sequences across marine mammals like Kogia breviceps (pygmy sperm whale) and other cetaceans, researchers can identify conserved regions crucial for function versus variable regions that may represent adaptive evolution. Molecular clock analyses similar to those performed on sperm whales (estimated TMRCA of 136.7 thousand years ago) can provide temporal context for these changes.

  • Selection pressure analysis: Calculating dN/dS ratios across the MT-ND4L gene can identify regions under purifying or positive selection, potentially revealing functionally critical domains.

  • Structure-function correlations: Mapping sequence variations onto structural models can identify if changes occur in functionally important regions like proton channels or ubiquinone binding sites.

  • Biochemical characterization: Comparative analyses of Complex I activity from different species can determine if sequence variations correlate with functional differences in catalytic efficiency, oxygen affinity, or proton pumping capacity.

  • Environmental adaptation: Correlating MT-ND4L variations with ecological parameters (dive depth, temperature ranges) can reveal adaptations specific to marine mammal bioenergetics.

Researchers should consider that marine mammals have undergone significant mitochondrial adaptations to accommodate their hypoxic diving lifestyle, potentially affecting Complex I components like MT-ND4L. Population genetic approaches, similar to the skyline and skygrid analyses mentioned for whale populations , can help identify if certain variants have undergone selective sweeps.

How can recombinant MT-ND4L be used to investigate mitochondrial disease mechanisms?

Recombinant MT-ND4L offers unique opportunities to investigate mitochondrial disease mechanisms through several sophisticated approaches:

  • Patient mutation modeling: Introducing patient-derived mutations into recombinant Kogia breviceps MT-ND4L can create experimental models to study specific mitochondrial diseases. This approach parallels studies of NDUFS4 mutations associated with complex I deficiency and fatal neurological syndrome .

  • Interspecies complementation: Evaluating whether MT-ND4L from different species can functionally complement deficiencies in human cells can reveal conserved disease mechanisms. The evolutionary distance between marine mammals and humans makes this particularly interesting.

  • Tissue-specific effects: Expressing recombinant MT-ND4L in different cell types (neurons, muscle cells, fibroblasts) can help explain the tissue-specific manifestations of mitochondrial diseases. Research has shown that fibroblast and myoblast cultures exhibit distinct responses to cAMP-dependent phosphorylation of Complex I components .

  • Interaction with assembly factors: Investigating how disease-causing mutations affect interactions with assembly factors like NDUFAF1-4, ACAD9, ECSIT, FOXRED1, and TMEM126B can reveal mechanisms of assembly failure in pathological conditions.

  • Post-translational modification studies: Analyzing how disease-relevant mutations affect phosphorylation or other modifications of MT-ND4L, especially in light of findings that cAMP-dependent phosphorylation can regulate Complex I activity .

Research has shown that mutations in Complex I components can lead to fatal neurological syndromes, with specific mechanisms including disruption of phosphorylation sites or premature termination of proteins, affecting either activation or assembly of the complex .

What strategies can overcome aggregation issues when working with recombinant MT-ND4L?

The hydrophobic nature of MT-ND4L presents significant challenges related to protein aggregation. Researchers can implement several strategies to address these issues:

  • Optimized solubilization conditions:

    • Systematic screening of detergent types, concentrations, and combinations

    • Incorporation of lipids from native mitochondrial membranes

    • Use of amphipathic polymers like amphipols or SMALPs (styrene-maleic acid lipid particles)

  • Expression modifications:

    • Fusion with solubility-enhancing tags (MBP, SUMO, Mistic)

    • Co-expression with interaction partners to stabilize protein folding

    • Directed evolution approaches to identify more soluble variants

  • Alternative reconstitution approaches:

    • Direct incorporation into nanodiscs or liposomes during or immediately after translation

    • Cell-free expression systems with membrane mimetics present during synthesis

  • Analytical techniques for quality assessment:

    • Dynamic light scattering to monitor aggregation state

    • Analytical ultracentrifugation to characterize oligomeric state

    • Thermal shift assays to identify stabilizing conditions

  • Computational approaches:

    • Molecular dynamics simulations to identify aggregation-prone regions

    • Structure-guided mutagenesis to reduce aggregation propensity

When implementing these strategies, researchers should systematically document conditions using a decision tree approach, testing combinations of buffers, pH values, salt concentrations, and detergents to identify optimal conditions for their specific experimental needs.

How can researchers accurately assess interactions between MT-ND4L and other Complex I components?

Investigating protein-protein interactions involving hydrophobic membrane proteins like MT-ND4L requires specialized approaches:

  • In vitro interaction studies:

    • Microscale thermophoresis (MST) in detergent micelles or nanodiscs

    • Surface plasmon resonance (SPR) with captured liposomes containing MT-ND4L

    • Isothermal titration calorimetry (ITC) adapted for membrane proteins

  • Chemical biology approaches:

    • Photo-crosslinking with unnatural amino acids incorporated at specific positions

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map interaction interfaces

    • FRET-based assays using reconstituted components in membrane mimetics

  • Cellular interaction studies:

    • Proximity labeling approaches (BioID, APEX) in mitochondria

    • Split complementation assays adapted for the mitochondrial environment

    • Coevolution analysis to predict interaction partners

  • Structural approaches:

    • Single-particle cryo-EM of partially assembled complexes

    • Cross-linking mass spectrometry (XL-MS) to identify distance constraints

    • Integrative structural modeling combining multiple data sources

These approaches can help elucidate how MT-ND4L interacts with other components during the assembly process, particularly in the context of the 550 kDa and 815 kDa subcomplexes identified in Complex I assembly studies . Understanding these interactions is crucial for interpreting how mutations might disrupt complex formation and lead to mitochondrial dysfunction.

How do post-translational modifications of MT-ND4L compare across species?

Post-translational modifications (PTMs) of MT-ND4L show interesting variations across species that can provide insights into regulatory mechanisms and evolutionary adaptations:

  • Phosphorylation patterns: Research has shown that cAMP-dependent phosphorylation of Complex I components can regulate activity . A systematic analysis of phosphorylation sites in MT-ND4L across species can reveal:

    • Conserved phosphorylation motifs indicating fundamental regulatory mechanisms

    • Species-specific sites that may relate to metabolic adaptations

    • Environmental influences on phosphorylation patterns (e.g., diving mammals vs. terrestrial mammals)

  • Other PTMs: Beyond phosphorylation, MT-ND4L may undergo additional modifications:

    • Acetylation patterns that respond to metabolic state

    • Oxidative modifications that may indicate stress responses

    • Ubiquitination or SUMOylation that could regulate turnover

  • Regulatory enzymes: Comparing the mitochondrial kinases, phosphatases, and other modifying enzymes across species can provide insights into regulatory divergence. For example, research has identified Ca²⁺-inhibited phosphatases in mitochondria that dephosphorylate Complex I components .

  • Functional consequences: Experimental approaches to determine how species-specific PTMs affect:

    • Complex I activity and electron transfer rates

    • Response to environmental stressors

    • Assembly efficiency and subcomplex formation

What molecular clock analyses reveal about the evolution of MT-ND4L in marine mammals?

Molecular clock analyses of MT-ND4L in marine mammals provide valuable insights into evolutionary timescales and selection pressures:

  • Divergence time estimates: Using calibrated molecular clocks similar to those applied to other mitochondrial genes in cetaceans (which estimated TMRCAs around 136.7 thousand years ago with 95% CI 85.2-201.1 KYA) , researchers can establish when key changes in MT-ND4L occurred in the Kogia breviceps lineage.

  • Substitution rate analysis:

    • MT-ND4L may show different substitution rates compared to other mitochondrial genes

    • The estimated substitution rate for mitochondrial genes in cetaceans (approximately 7.034E-3 substitutions per site per million years) provides a reference point

  • Demographic inference: Skyline and skygrid analyses similar to those performed on whale populations can link MT-ND4L evolution to population expansions and contractions:

    • Population expansions beginning 30-35 KYA (skyline) or >80 KYA (skygrid) may correlate with fixation of adaptive variants

    • Bottlenecks may explain reduced diversity in certain regions of the gene

  • Adaptive evolution analyses:

    • Branch-site models to detect episodic positive selection

    • Tests for relaxed selection in deep-diving lineages

    • Correlation between diving physiology adaptations and MT-ND4L sequence changes

Analysis TypeMethodKey ParametersExpected Outcome
Divergence DatingBayesian MCMCCalibration points, substitution modelTMRCA for MT-ND4L variants
Population DemographicsBayesian Skyline/SkygridCoalescent model, population size priorsHistorical population size changes
Selection AnalysisdN/dS ratio testsCodon alignment, phylogenetic treeSites under positive/purifying selection
Ancestral ReconstructionMaximum likelihoodSubstitution model, phylogenySequence changes along key branches

These analyses can reveal whether MT-ND4L has undergone adaptive evolution specifically in marine mammals like Kogia breviceps, potentially in response to the unique bioenergetic demands of deep diving and oxygen limitation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.