Recombinant Koribacter versatilis ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Functional Role in ATP Synthase

ATP synthase subunit a is essential for proton translocation across the inner mitochondrial membrane in eukaryotes and bacterial cell membranes. In Koribacter, it facilitates:

  • Proton Channel Formation: Directs protons through the F₀ sector, driving the rotation of the c-ring .

  • Energy Coupling: Coordinates proton flow with ATP synthesis in the F₁ sector via the peripheral stalk .

While structural data for Koribacter atpB is limited, homology to Bacillus and E. coli ATP synthases suggests conserved mechanisms .

Research Applications and Findings

Recombinant atpB is used in:

  • Biochemical Assays: Studying proton translocation kinetics and ATP synthesis efficiency.

  • Structural Studies: Cryo-EM or X-ray crystallography to elucidate F₀ sector dynamics .

Comparative Insights from Bacterial ATP Synthases

FeatureBacterial ATP Synthase (e.g., Bacillus) Mitochondrial ATP Synthase
Subunit a StructureSingle transmembrane helicesMultiple helices (e.g., a and A6L)
Proton PathwayDirect transmembrane channelGated pathway (requires a and A6L)
Peripheral StalkSimpler, more flexibleComplex, rigid

These differences highlight bacterial ATP synthases as simpler models for studying energy conversion .

Production and Handling Considerations

  • Expression System: E. coli is the primary host due to its compatibility with His-tagged proteins .

  • Purification: Affinity chromatography (His tag) followed by size-exclusion chromatography .

  • Stability: Lyophilized powders are stable at -20°C/-80°C, while liquid formulations require glycerol for long-term storage .

Future Research Directions

  1. Cryo-EM Structural Analysis: Resolving Koribacter atpB in different rotational states to map proton translocation pathways.

  2. Functional Mutagenesis: Identifying residues critical for proton gating and ATP synthesis.

  3. Ecological Relevance: Linking Koribacter ATP synthase activity to its role in soil carbon cycling and CO oxidation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
atpB; Acid345_1299; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-245
Protein Length
full length protein
Species
Koribacter versatilis (strain Ellin345)
Target Names
atpB
Target Protein Sequence
MPHQLWFTAFLNQYLAGPVSAMMSVLHVPNPHPRAPISNYVAMEILVFLLLVLFFIATRI SLSWDKPGVLQHIAEGMNNFVSNQGEEMIGHGYETYTSYIVTLGVFILSMNLIGLIPGFE APTAFPSVPLGCALVTWFFYHVHGLRENGVIGYLKHFLGPVWWISPLLFVIEICSHFARI MSLTIRLYANMFAGDMVTLAFFSLVPLGFPVVFMGLHIFVSLIQTYIFITLAAVYLAEAT AHGHD
Uniprot No.

Target Background

Function

Key component of the proton channel; it plays a crucial role in proton translocation across the membrane.

Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Koribacter versatilis ATP synthase subunit a (atpB) and what is its function in cellular metabolism?

Koribacter versatilis ATP synthase subunit a (atpB) is a critical component of the F0 sector of ATP synthase. The protein is encoded by the atpB gene (also known as Acid345_1299) and functions as part of the membrane-embedded portion of ATP synthase. This subunit plays an essential role in proton translocation across the membrane during ATP synthesis, serving as a channel for protons to pass through the membrane, ultimately driving the synthesis of ATP from ADP and inorganic phosphate .

As a member of the F-ATPase complex, this protein contributes to energy conservation in K. versatilis, a process particularly important in its native acidic environments. The protein contains several transmembrane domains that anchor it within the cell membrane, where it interacts with other subunits of the ATP synthase complex to facilitate the chemiosmotic coupling mechanism.

What is the taxonomic and ecological context of Koribacter versatilis?

Koribacter versatilis belongs to the phylum Acidobacteria, a diverse group of bacteria that are particularly abundant in soil environments. K. versatilis is taxonomically distinct, showing approximately 56% amino acid identity (AAI) to its closest relatives within Acidobacteria, which is lower than AAIs typically observed among members of known acidobacterial genera .

Ecologically, K. versatilis and related Acidobacteria are significant in anaerobic degradation processes in peatlands and acidic soil environments . These organisms possess respiratory chains that include NADH dehydrogenase 1, succinate dehydrogenase, quinol-cytochrome-c reductase variants, low-affinity terminal oxidases, and ATP synthase, enabling them to adapt to their ecological niches . Their metabolic versatility may include involvement in sulfur metabolism, with some related Acidobacteria showing evidence of dissimilatory sulfur metabolism .

How is recombinant K. versatilis ATP synthase subunit a typically expressed and purified for research?

The recombinant K. versatilis ATP synthase subunit a is typically expressed in E. coli expression systems. The standard methodology involves:

  • Cloning the full-length gene (encoding amino acids 1-245) into an expression vector

  • Adding an N-terminal His-tag to facilitate purification

  • Expressing the protein in E. coli under appropriate induction conditions

  • Purifying the protein using affinity chromatography (typically nickel column purification)

  • Verifying protein purity by SDS-PAGE (should be greater than 90% pure)

  • Processing to a lyophilized powder for storage

This approach allows researchers to obtain significant quantities of the protein for structural and functional studies. The expression in E. coli provides a balance between yield and proper folding of the protein, although as a membrane protein, optimization of expression conditions may be necessary for maximum yield .

What are the optimal storage and handling conditions for recombinant K. versatilis atpB?

Proper storage and handling are crucial for maintaining the structural integrity and activity of recombinant K. versatilis atpB. The following protocols are recommended based on experimental evidence:

ParameterRecommendation
Storage temperature-20°C/-80°C upon receipt
Physical formLyophilized powder
Storage bufferTris/PBS-based buffer with 6% Trehalose, pH 8.0
Working storageAliquots at 4°C for up to one week
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mL
Long-term preservationAdd 5-50% glycerol (final concentration)

Critical notes for researchers:

  • Brief centrifugation of the vial prior to opening is recommended to bring contents to the bottom

  • Repeated freezing and thawing is strongly discouraged as it significantly reduces protein stability and activity

  • Aliquoting is necessary for multiple use to minimize freeze-thaw cycles

How can researchers assess the quality and activity of purified K. versatilis atpB?

Quality assessment of purified K. versatilis atpB should involve multiple complementary approaches:

  • Purity verification:

    • SDS-PAGE analysis should demonstrate >90% purity

    • Western blotting using anti-His antibodies can confirm identity for His-tagged proteins

  • Structural integrity assessment:

    • Circular dichroism spectroscopy to analyze secondary structure elements

    • Size exclusion chromatography to verify protein homogeneity and detect aggregation

    • Limited proteolysis to confirm proper folding

  • Functional characterization:

    • For complete functional assessment, reconstitution with other ATP synthase subunits may be necessary

    • Proteoliposome reconstitution allows assessment in a membrane environment

    • ATP hydrolysis/synthesis assays when incorporated into functional complexes

    • Proton translocation assays using fluorescent pH indicators

Researchers should be aware that as an integral membrane protein, functional assays require incorporation into a lipid environment that mimics its native membrane context.

How does K. versatilis ATP synthase compare structurally and functionally with ATP synthases from other organisms?

Comparative analysis of K. versatilis ATP synthase reveals several noteworthy aspects:

  • Comparison with other Acidobacteria:
    K. versatilis ATP synthase shows significant evolutionary divergence from other Acidobacteria, with only 56% amino acid identity to its closest relatives . This suggests potential functional adaptations specific to K. versatilis. The ATP synthase is part of respiratory chains found in acidobacterial genomes, typically functioning alongside NADH dehydrogenase 1, succinate dehydrogenase, and various types of cytochrome complexes .

  • Comparison with model bacterial systems:
    Unlike the well-characterized ATP synthases from model organisms such as E. coli, the K. versatilis enzyme likely possesses adaptations for functioning in acidic environments. These may include modifications to proton-binding sites and changes in the transmembrane regions that affect proton translocation efficiency.

  • Ecological and evolutionary significance:
    The distinct characteristics of K. versatilis ATP synthase likely reflect adaptations to its ecological niche in acidic soils and peatlands. Studying these adaptations can provide insights into how ATP synthases evolve to function efficiently in different environmental conditions.

What role might ATP synthase play in the anaerobic metabolism of K. versatilis?

The ATP synthase of K. versatilis likely serves multiple roles in anaerobic metabolism:

  • Integration with respiratory chains:
    In Acidobacteria, ATP synthase works in conjunction with respiratory chain components that include NADH dehydrogenase 1, succinate dehydrogenase, and various cytochrome complexes . Under anaerobic conditions, these respiratory chains may use alternative electron acceptors.

  • Adaptation to fluctuating oxygen conditions:
    While many Acidobacteria in subdivisions 1 and 3 are strict aerobes or facultative anaerobes, K. versatilis and related species likely have adaptations for anaerobic metabolism . The ATP synthase may function bidirectionally depending on energy status, potentially operating in reverse (hydrolyzing ATP) to maintain membrane potential under energy-limited conditions.

  • Connection to sulfur metabolism:
    Some Acidobacteria related to K. versatilis possess genes for dissimilatory sulfur metabolism . The ATP synthase may be energetically coupled to sulfur reduction pathways, potentially utilizing the proton gradient generated during these processes.

  • Hydrogen metabolism interaction:
    The identification of [NiFe] hydrogenases in related Acidobacteria suggests potential coupling between hydrogen metabolism and ATP synthesis under anaerobic conditions . This connection would provide metabolic flexibility in anoxic environments.

What methodological approaches are recommended for studying K. versatilis atpB interactions with other ATP synthase subunits?

Investigating the interactions between K. versatilis atpB and other ATP synthase subunits requires specialized approaches:

  • Co-expression systems:

    • Dual or multi-vector expression systems in E. coli

    • Construction of operons expressing multiple subunits in defined ratios

    • Cell-free expression systems for membrane protein complexes

  • Interaction analysis techniques:

    • Cross-linking mass spectrometry (XL-MS) to map interaction interfaces

    • Cryo-electron microscopy for structural analysis of the assembled complex

    • Förster resonance energy transfer (FRET) using fluorescently labeled subunits

    • Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) for binding affinity measurements

  • Functional reconstitution approaches:

    • Sequential incorporation of purified subunits into liposomes

    • Co-reconstitution of multiple subunits simultaneously

    • Measurement of ATP synthesis/hydrolysis in reconstituted systems

    • Proton pumping assays using pH-sensitive fluorescent dyes

  • Genetic approaches:

    • Construction of chimeric proteins with subunits from model organisms

    • Site-directed mutagenesis of predicted interaction interfaces

    • Suppressor mutation analysis to identify compensatory changes

These methodological approaches can provide comprehensive insights into how K. versatilis atpB interacts with other subunits to form a functional ATP synthase complex.

What are common challenges in working with recombinant K. versatilis atpB and how can they be addressed?

Researchers working with recombinant K. versatilis atpB face several technical challenges that require specific solutions:

  • Membrane protein solubility issues:

    • Challenge: As an integral membrane protein, atpB has hydrophobic domains that can cause aggregation.

    • Solution: Use appropriate detergents (DDM, LMNG, CHAPS) during purification. The inclusion of 6% trehalose in the storage buffer helps maintain solubility .

  • Protein stability concerns:

    • Challenge: Repeated freeze-thaw cycles significantly reduce protein activity.

    • Solution: Prepare single-use aliquots and store at -80°C. Working stocks should be kept at 4°C for no more than one week .

  • Expression yield limitations:

    • Challenge: Membrane proteins often express poorly in heterologous systems.

    • Solution: Optimize expression conditions including E. coli strain selection, induction temperature (typically lower temperatures improve folding), and inducer concentration.

  • Functional assessment difficulties:

    • Challenge: Demonstrating functional activity requires a membrane environment.

    • Solution: Reconstitute into proteoliposomes of defined lipid composition. Consider co-expression with other ATP synthase subunits or reconstitution with purified subunits from model organisms.

  • Structural characterization complexity:

    • Challenge: Obtaining structural information is difficult for membrane proteins.

    • Solution: Use detergent screening to identify conditions suitable for structural studies. Consider newer approaches like lipid nanodiscs or amphipols to maintain native-like environments.

How can researchers optimize reconstitution of K. versatilis atpB for functional studies?

Successful reconstitution of K. versatilis atpB for functional studies requires careful optimization of several parameters:

  • Detergent selection and removal:

    • Initially solubilize the purified protein in mild detergents compatible with membrane proteins

    • Test multiple detergent types (DDM, LMNG, CHAPS) to identify optimal conditions

    • Remove detergent gradually using controlled methods (dialysis, Bio-Beads, cyclodextrin)

  • Lipid composition optimization:

    • Test various lipid compositions to identify those that best support protein function

    • Consider including negatively charged lipids (phosphatidylglycerol, cardiolipin)

    • Adjust lipid-to-protein ratios systematically (typically test ratios from 10:1 to 100:1)

  • Reconstitution methodology:

    • For proteoliposomes: Use detergent-mediated reconstitution with controlled detergent removal

    • For nanodiscs: Assemble with appropriate membrane scaffold proteins

    • For co-reconstitution: Determine optimal order of addition and protein ratios

  • Functional verification approaches:

    • Assess protein orientation in proteoliposomes using proteolytic digestion

    • Verify incorporation efficiency using density gradient centrifugation

    • Measure proton translocation using pH-sensitive fluorescent dyes

    • When co-reconstituted with other subunits, measure ATP synthesis/hydrolysis activities

  • Quality control throughout the process:

    • Monitor protein solubility and aggregation state during reconstitution

    • Verify vesicle size and homogeneity using dynamic light scattering

    • Assess protein:lipid ratio in the final preparation

These methodological details are critical for obtaining functionally relevant results when studying K. versatilis atpB in reconstituted systems.

How might comparative studies between K. versatilis atpB and other acidobacterial ATP synthases advance our understanding of bioenergetic adaptations?

Comparative studies offer several promising research avenues:

  • Evolutionary adaptation mechanisms:

    • Systematic comparison of atpB sequences across Acidobacteria inhabiting different pH environments could reveal adaptive mutations

    • Correlation of sequence variations with habitat pH might identify key residues involved in proton handling

    • Ancestral sequence reconstruction could illuminate the evolutionary trajectory of acidobacterial ATP synthases

  • Structure-function relationships across ecological gradients:

    • Comparing ATP synthases from acidophilic, neutrophilic, and alkaliphilic Acidobacteria could reveal pH-adaptive mechanisms

    • Analysis of proton-binding sites and channels across different species may identify conserved versus variable elements

    • Investigation of how subunit interactions differ between species could reveal flexibility in assembly mechanisms

  • Experimental approaches for comparative studies:

    • Creation of chimeric proteins combining domains from different acidobacterial sources

    • Site-directed mutagenesis to introduce key residues from one species into another

    • In vitro functionality tests across pH gradients for ATP synthases from different acidobacterial species

  • Ecological and physiological context:

    • Connection between ATP synthase adaptations and ecological distribution of Acidobacteria

    • Relationship between genome content (respiratory chain components) and ATP synthase structure

    • Correlation between growth capabilities and ATP synthase characteristics

These comparative approaches could significantly advance our understanding of how ATP synthases adapt to diverse environmental conditions, with potential applications beyond Acidobacteria to bioenergetic systems in general.

What potential applications exist for K. versatilis atpB in biotechnology or synthetic biology?

K. versatilis atpB and related acidobacterial ATP synthase components offer several promising applications:

  • Bioenergetic modules for synthetic biology:

    • Engineering of pH-tolerant ATP synthesis modules for synthetic cells

    • Creation of hybrid energy-generating systems combining elements from different organisms

    • Development of minimal ATP synthase systems with tailored properties

  • Biosensors and analytical tools:

    • Development of ATP synthase-based biosensors for monitoring environmental parameters

    • Creation of analytical tools for measuring proton gradients in complex systems

    • Engineering of reporter systems for bioenergetic functions

  • Biomimetic energy conversion:

    • Inspiration for artificial energy-converting systems based on natural principles

    • Development of nanoscale rotary motors mimicking ATP synthase function

    • Creation of biomimetic membranes with incorporated ATP synthase components

  • Pharmaceutical and biomedical applications:

    • Potential targets for antimicrobial development against related pathogenic bacteria

    • Templates for designing inhibitors of ATP synthesis in specific microbial groups

    • Models for understanding bioenergetic dysfunction in human diseases

  • Environmental biotechnology:

    • Components for engineered microorganisms designed for bioremediation of acidic environments

    • Development of systems for energy harvesting from low pH environments

    • Creation of organisms with enhanced survival in acidic industrial waste streams

These applications represent the translation of fundamental research on K. versatilis atpB into practical biotechnological tools, highlighting the importance of basic research on diverse biological systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.