Recombinant Koribacter versatilis Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Biological Role in K. versatilis

K. versatilis, a soil-dwelling Acidobacterium, relies on PlsY for membrane lipid synthesis. This enzyme catalyzes the first step in phospholipid biosynthesis, critical for maintaining membrane integrity in fluctuating soil environments . Genomic studies highlight K. versatilis's metabolic versatility, including carbohydrate degradation and nitrogen scavenging, traits supported by its lipid metabolism . Notably, K. versatilis accounts for up to 14% of soil bacterial communities, underscoring its ecological significance .

Research Applications

Recombinant PlsY is utilized in:

  • Enzyme kinetics studies: Investigating substrate specificity and inhibition mechanisms.

  • Structural biology: Crystallography and mutagenesis to map active sites .

  • Biotechnological applications: Engineering lipid pathways in synthetic biology .

Comparative Genomic Insights

Genomic analyses of Acidobacteria reveal that plsY homologs are widespread, but K. versatilis PlsY exhibits unique features:

  • Phage integration: Prophage-derived elements in K. versatilis may influence genetic plasticity, potentially affecting plsY regulation .

  • Metabolic flexibility: Coupled with high-affinity transporters, PlsY supports growth under oligotrophic conditions .

Stability and Handling

  • Storage: Lyophilized form ensures stability; reconstituted protein retains activity for one week at 4°C .

  • Activity loss: Repeated freeze-thaw cycles reduce enzymatic efficiency .

Product Specs

Form
Lyophilized powder
Note: While we preferentially ship the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format when placing your order, and we will do our best to fulfill your requirement.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributor.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize the development of your specified tag.
Synonyms
plsY; Acid345_2138; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Koribacter versatilis (strain Ellin345)
Target Names
plsY
Target Protein Sequence
MKTFVPIALLAYLCGSIPFGFILVKLFLKADVRQTGSGNIGATNVARTGAKGLAVLTLLL DAVKGWVAVFAATIFIARVSNPANVDVRLIPAFAGLCAILGHLYPVWLKFKGGKGVATAL GVFLALAPTPIGIVLGLFALVVLLTHYISLGSILAAAAFPFVVYFLYRNQYPAATYAIMG ASSLLIIWRHRSNIQRLIAGTENRFPASKPTEGKA
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). While it utilizes acyl-phosphate as a fatty acyl donor, it does not utilize acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of plsY in Koribacter versatilis?

Koribacter versatilis, a member of the Acidobacteriota phylum, contains a circular chromosome with 5,650,368 nucleotides encoding 4,777 proteins and 55 RNA genes . The plsY gene in K. versatilis exists within this genomic framework and plays a critical role in phospholipid biosynthesis. When analyzing the genomic context, researchers should employ comparative genomics approaches to identify conserved regions flanking the plsY gene, which may indicate functional relationships with other genes involved in membrane lipid metabolism. Phylogenetic analysis reveals that K. versatilis is distinct from other lineages within the Acidobacteria, showing a major split from related species in subdivision 1 .

How does K. versatilis plsY compare to plsY homologs from other bacterial species?

When comparing K. versatilis plsY to homologs from other bacterial species, researchers should utilize multiple sequence alignment tools (e.g., MUSCLE, CLUSTALW) followed by phylogenetic tree construction. The analysis should focus on conserved catalytic domains and substrate-binding regions. K. versatilis belongs to the Acidobacteriota phylum, which is only distantly related to other bacterial phyla , suggesting its plsY may have unique structural or functional characteristics compared to well-studied homologs from model organisms. The adaptation of K. versatilis to soil environments with potentially varying phospholipid requirements may be reflected in its plsY sequence and activity profile.

What are the optimal expression conditions for recombinant K. versatilis plsY?

To determine optimal expression conditions for recombinant K. versatilis plsY, researchers should systematically evaluate:

ParameterTesting RangeConsiderations
Expression hostE. coli BL21(DE3), C41(DE3), Rosetta(DE3), etc.K. versatilis has distinct codon usage that may require optimization
Induction temperature16°C, 25°C, 30°C, 37°CLower temperatures may improve folding of membrane-associated proteins
Induction duration4h, 8h, 16h, 24hExtended induction may increase yield but risk inclusion body formation
IPTG concentration0.1 mM, 0.5 mM, 1.0 mMLower concentrations may improve solubility
Media compositionLB, TB, 2xYT, M9 minimalRich media enhances yield, minimal media allows isotopic labeling

Consider that K. versatilis is a slow-growing soil bacterium that can take up to a week to form visible colonies , suggesting its proteins may require extended expression times or specialized conditions for optimal folding and activity.

What purification strategies are most effective for obtaining active K. versatilis plsY?

Effective purification of active K. versatilis plsY requires careful consideration of its membrane-associated nature. A methodological approach includes:

  • Initial extraction: Use mild detergents (DDM, LDAO, or Triton X-100) at concentrations just above their critical micelle concentration to solubilize plsY while maintaining its native conformation.

  • Affinity chromatography: Employ His-tag purification with imidazole gradient elution (20-250 mM) in the presence of detergent.

  • Size exclusion chromatography: Remove aggregates and achieve higher purity using buffers containing reduced detergent concentrations.

  • Activity preservation: Include glycerol (10-20%) and reducing agents (1-5 mM DTT or β-mercaptoethanol) in all buffers.

As K. versatilis is adapted to acidic soil environments, consider testing purification at various pH ranges (5.0-7.5) to identify conditions that maximize enzyme stability and activity. Integration of these strategies should be experimentally verified using both activity assays and structural integrity assessments.

How can researchers establish reliable activity assays for K. versatilis plsY?

Establishing reliable activity assays for K. versatilis plsY requires a multifaceted approach:

  • Radiometric assay: Track the incorporation of [³H]-labeled glycerol-3-phosphate into acylated products using thin-layer chromatography and scintillation counting.

  • Spectrophotometric assay: Couple plsY activity to reactions that produce measurable absorbance changes, such as monitoring ACP (acyl carrier protein) release using Ellman's reagent.

  • Fluorescence-based assay: Develop assays using fluorescently labeled substrates or coupling reactions that generate fluorescent products.

  • HPLC/MS analysis: Quantify product formation directly through chromatographic separation and mass spectrometry.

When optimizing these assays, researchers should systematically evaluate:

ParameterRange to TestConsiderations
pH4.0-8.0K. versatilis thrives in acidic environments
Temperature20-50°CTest thermal stability and optimal activity temperature
Metal ionsMg²⁺, Mn²⁺, Zn²⁺, Ca²⁺Identify cofactor requirements or inhibition
Acyl-donor specificityVarious acyl-ACPs or acyl-CoAsDetermine substrate preference profile

Remember that the acidic soil habitat of K. versatilis suggests its enzymes may have evolved unique pH optima and substrate preferences compared to homologs from neutrophilic bacteria.

What structural features distinguish K. versatilis plsY, and how can they be determined experimentally?

To characterize the structural features of K. versatilis plsY, researchers should employ multiple complementary approaches:

  • Homology modeling: Generate preliminary structural models based on crystal structures of plsY homologs, accounting for sequence divergence in K. versatilis.

  • Site-directed mutagenesis: Systematically alter predicted catalytic residues to confirm their functional importance.

  • Crystallography or cryo-EM: For definitive structural determination, optimize protein preparation for either X-ray crystallography or cryo-electron microscopy.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Map conformational dynamics and substrate interactions without requiring crystallization.

  • Circular dichroism (CD) spectroscopy: Evaluate secondary structure content and thermal stability.

Given that K. versatilis belongs to the phylum Acidobacteriota with phylogenetic diversity similar to that of Proteobacteria , researchers should anticipate potential structural adaptations that differ from well-characterized model systems. The unique environmental adaptations of K. versatilis, including growth in acidic conditions and high reliance on iron , may be reflected in specific structural features of its plsY enzyme.

How do environmental factors affect the function of K. versatilis plsY?

K. versatilis thrives in soil environments where it contributes significantly to carbon cycling . To understand how environmental factors affect plsY function:

  • pH-dependent activity profile: Systematically measure enzyme activity across a pH range (4.0-8.0), with particular attention to acidic conditions that mimic the natural habitat of K. versatilis.

  • Temperature effects: Evaluate both optimal temperature for activity and thermal stability profiles, considering the soil temperature fluctuations.

  • Metal ion dependencies: Test activity in the presence of various metal ions, with particular attention to iron, which is critical for K. versatilis survival .

  • Redox sensitivity: Assess activity under varying redox conditions that might reflect soil microenvironments.

Environmental FactorTesting ConditionsExpected Impact on plsY
pH4.0, 5.0, 6.0, 7.0, 8.0Likely optimal activity in acidic range
Temperature10°C, 20°C, 30°C, 40°C, 50°CActivity profile reflecting soil temperature adaptations
Iron concentration0, 1, 5, 10, 50, 100 μMPotential structural or regulatory effects
Oxygen levelsAnaerobic, microaerobic, aerobicMay show activity adaptations reflecting soil oxygen gradients

These experimental investigations should be designed with statistical robustness, including sufficient replicates (n≥3) and appropriate controls to account for buffer and substrate effects independent of the environmental parameter being tested.

How can researchers address expression challenges when K. versatilis plsY forms inclusion bodies?

When K. versatilis plsY forms inclusion bodies during recombinant expression, researchers should implement a systematic troubleshooting approach:

  • Solubility enhancement strategies:

    • Reduce induction temperature to 16-20°C

    • Decrease IPTG concentration to 0.1-0.2 mM

    • Co-express with molecular chaperones (GroEL/ES, DnaK/J)

    • Utilize specialized expression strains (C41/C43, ArcticExpress)

    • Test fusion partners (MBP, SUMO, TrxA) known to enhance solubility

  • Inclusion body refolding methodology:

    • Isolate inclusion bodies using differential centrifugation

    • Solubilize using strong denaturants (6-8M urea or 6M guanidine HCl)

    • Refold by gradual denaturant removal through dialysis or dilution

    • Incorporate phospholipids or detergent micelles during refolding

    • Implement on-column refolding using immobilized metal affinity chromatography

  • Activity recovery assessment:

    • Compare specific activities of refolded versus solubly expressed enzyme

    • Analyze structural integrity using circular dichroism and thermal shift assays

This methodological framework should be adapted based on the specific challenges encountered with K. versatilis plsY, considering that its native host has a highly capsulated cell structure that may influence the natural folding environment of the enzyme.

What approaches can resolve contradictory kinetic data for K. versatilis plsY with different acyl chain substrates?

When faced with contradictory kinetic data for K. versatilis plsY with different acyl chain substrates, researchers should implement a systematic investigation:

  • Standardize assay conditions:

    • Use consistent buffer systems, pH, and temperature across all experiments

    • Ensure substrate purity and preparation methods are identical

    • Verify enzyme concentration determination methodology

    • Establish clear steady-state conditions for all measurements

  • Comprehensive substrate profiling:

    • Test a complete series of acyl chain lengths (C8-C20)

    • Include both saturated and unsaturated acyl chains

    • Evaluate both acyl-ACP and acyl-CoA as potential donors

    • Determine competitive kinetics with mixed substrates

  • Advanced kinetic analysis:

    • Apply multiple kinetic models (Michaelis-Menten, cooperative, substrate inhibition)

    • Perform global data fitting across multiple experiments

    • Implement isothermal titration calorimetry for direct binding measurements

    • Utilize pre-steady-state kinetics to identify rate-limiting steps

  • Structural context:

    • Correlate kinetic differences with molecular docking simulations

    • Identify potential allosteric binding sites that might influence substrate preference

    • Design site-directed mutants to test structural hypotheses

Given that K. versatilis is adapted to soil environments and participates in carbon cycling , its plsY may have evolved unique substrate preferences that reflect the membrane lipid requirements for survival in its ecological niche.

How can researchers integrate plsY functional studies with K. versatilis ecology?

Integrating plsY functional studies with K. versatilis ecology requires a multidisciplinary approach that connects molecular function to ecological roles:

  • Environmental sampling and expression analysis:

    • Collect soil samples from diverse environments

    • Quantify plsY expression levels using RT-qPCR

    • Correlate expression with soil parameters (pH, organic content, temperature)

    • Compare expression patterns with other phospholipid biosynthesis genes

  • Membrane adaptation studies:

    • Analyze membrane lipid composition of K. versatilis across environmental gradients

    • Correlate lipid profiles with plsY activity and substrate preference

    • Investigate temperature-dependent membrane adaptations and corresponding plsY function

  • Ecological significance assessment:

    • Develop knockout or knockdown systems to modulate plsY activity in situ

    • Measure impacts on K. versatilis survival and population dynamics

    • Assess effects on carbon cycling processes, as K. versatilis plays a significant role in CO oxidation and polymer degradation

This integrative approach acknowledges that K. versatilis can constitute up to 14% of soil bacterial communities , suggesting that its phospholipid metabolism, mediated by plsY, may have ecosystem-level implications for carbon cycling and soil microbial community structure.

What computational approaches can predict substrate specificity of K. versatilis plsY?

Predicting substrate specificity of K. versatilis plsY through computational approaches requires multiple layers of analysis:

  • Sequence-based prediction:

    • Multiple sequence alignment with biochemically characterized plsY enzymes

    • Identification of conserved and divergent residues in substrate-binding regions

    • Machine learning classification based on substrate preference of homologs

  • Structural modeling and docking:

    • Generate homology models based on available plsY crystal structures

    • Perform molecular docking with various acyl chain substrates

    • Calculate binding energies and interaction profiles

    • Identify key residues that differentiate substrate preferences

  • Molecular dynamics simulations:

    • Evaluate dynamic interactions between enzyme and substrates

    • Simulate conformational changes upon substrate binding

    • Assess water accessibility to the active site with different substrates

    • Calculate free energy of binding through methods such as MM-PBSA

  • Integration with experimental validation:

    • Design critical mutations based on computational predictions

    • Perform targeted activity assays to validate computational models

    • Refine computational approaches based on experimental feedback

These computational methods should account for the unique evolutionary history of K. versatilis as a member of the Acidobacteriota phylum , which may have resulted in structural and functional adaptations of its plsY enzyme distinct from well-studied bacterial models.

How might researchers engineer K. versatilis plsY for biotechnological applications?

Engineering K. versatilis plsY for biotechnological applications requires a methodical approach focusing on enhancing desired properties:

  • Structure-guided protein engineering:

    • Identify catalytic residues and substrate-binding pockets using structural analysis

    • Design mutations to alter substrate specificity based on molecular docking

    • Create libraries of variants using site-directed mutagenesis and directed evolution

    • Implement high-throughput screening assays to identify improved variants

  • Stability enhancement strategies:

    • Apply computational design to identify stabilizing mutations

    • Incorporate disulfide bridges or salt bridges to improve thermostability

    • Test solvent-exposed residue modifications to enhance solubility

    • Evaluate fusion partners that might improve expression and stability

  • Application-specific optimizations:

    • For biocatalysis: Enhance activity with non-natural substrates

    • For biofuel production: Optimize activity with longer chain fatty acids

    • For biosensor development: Engineer substrate specificity for target compounds

  • Process integration considerations:

    • Develop immobilization strategies for continuous processes

    • Optimize reaction conditions for industrial applications

    • Evaluate compatibility with organic solvents or biphasic systems

This engineering approach should leverage the unique properties of K. versatilis, including its adaptation to varied soil environments and its natural involvement in carbon cycling , which might confer advantageous properties to its plsY enzyme for specific biotechnological applications.

What are the key challenges in studying the role of plsY in K. versatilis membrane homeostasis?

Investigating the role of plsY in K. versatilis membrane homeostasis presents several methodological challenges:

  • Genetic manipulation limitations:

    • K. versatilis has a slow growth rate (up to a week for visible colonies)

    • Limited genetic tools for acid-tolerant soil bacteria

    • Need for specialized cultivation conditions reflecting its natural habitat

    • Development of gene editing systems suitable for K. versatilis

  • Membrane analysis complexities:

    • Requirement for specialized lipid extraction protocols for highly capsulated cells

    • Comprehensive lipidomic analysis to detect subtle changes in membrane composition

    • Correlation of membrane changes with environmental adaptation mechanisms

    • Distinguishing plsY-specific effects from compensatory metabolic responses

  • Functional assessment challenges:

    • Establishing conditional knockout or knockdown systems

    • Developing real-time membrane composition monitoring techniques

    • Designing assays that connect membrane composition to cell physiology

    • Measuring membrane physical properties (fluidity, permeability) in live cells

  • Ecological context considerations:

    • Simulating relevant environmental conditions (pH, temperature, nutrients)

    • Accounting for interactions with other soil microbes

    • Measuring in situ membrane adaptations during environmental transitions

Addressing these challenges requires an integrated approach combining molecular biology, lipidomics, biophysics, and ecology, acknowledging the unique characteristics of K. versatilis as an environmentally significant member of soil microbial communities that contributes substantially to carbon cycling .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.