Recombinant Koribacter versatilis NADH-quinone oxidoreductase subunit K 2 (nuoK2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK2; Acid345_1306; NADH-quinone oxidoreductase subunit K 2; NADH dehydrogenase I subunit K 2; NDH-1 subunit K 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-103
Protein Length
full length protein
Species
Koribacter versatilis (strain Ellin345)
Target Names
nuoK2
Target Protein Sequence
MSSTIPLAWYLMLSAFLFICGVIGFMIKRNIITIFMCIELMLNAVNLTFVAYATELRSLS GHIFVFFVMVVAAAESAVGLGIIIAVFRSRETLNVDRVNLLKL
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transport from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, ubiquinone is considered the immediate electron acceptor for the enzyme. This process couples the redox reaction to proton translocation, translocating four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. Consequently, the redox energy is conserved within a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Koribacter versatilis and why is it significant in respiratory chain research?

Koribacter versatilis (formally designated "Candidatus Koribacter versatilis" Ellin345) is a member of the phylum Acidobacteria that was first isolated from soil in ryegrass/clover pasture in Australia in 2003. This organism is significant in respiratory chain research because it represents a widely distributed soil bacterium that can constitute up to 14% of soil bacterial communities in some environments . Despite its abundance, it grows very slowly and requires special culture conditions, which has historically limited our understanding of its physiological traits . As a member of the Acidobacteria, K. versatilis exhibits genomic, physiological, and metabolic versatility that allows it to thrive in challenging and fluctuating soil environments . Its NADH-quinone oxidoreductase (Complex I) represents an important model for understanding bacterial energy conservation mechanisms in soil-dwelling organisms.

How does the NADH-quinone oxidoreductase (Complex I) function in bacterial systems?

The proton-translocating NADH:quinone oxidoreductase (Complex I) functions as a multisubunit integral membrane enzyme within the respiratory chains of both bacteria and eukaryotic organelles. This enzyme catalyzes the reversible transfer of electrons from the soluble electron carrier NADH to membrane-bound quinone, coupling this reaction's energy to generate a proton motive force (PMF) . In bacterial systems, this reaction is fundamental to energy conservation and serves to:

  • Connect catabolism to energy conservation

  • Create approximately 40% of the PMF used for ATP synthesis (in aerobic respiration)

  • Reoxidize NADH produced during nutrient breakdown

  • Maintain cellular redox state by balancing NADH/NAD+ ratios

Interestingly, in some bacteria like the purple nonsulfur bacterium Rhodobacter capsulatus, Complex I can operate in reverse during phototrophic growth, using the PMF to drive NADH synthesis from quinol – demonstrating the enzyme's versatility in different metabolic contexts .

What is the specific role of the nuoK2 subunit within Complex I of K. versatilis?

The nuoK2 subunit is one of the membrane-embedded components of the 14-subunit proton-translocating NADH:quinone oxidoreductase in Koribacter versatilis. Based on comparative genomic analyses, nuoK2 represents a second isozyme variant of the standard nuoK subunit . The presence of this second isozyme (indicated by the "2" designation) suggests that K. versatilis possesses alternative or supplementary Complex I configurations that may be expressed under different environmental or metabolic conditions.

The nuoK subunit generally plays a critical role in the membrane domain of Complex I, contributing to the proton-translocating machinery. The presence of an alternative nuoK2 variant in K. versatilis likely reflects its adaptation to the fluctuating soil environment, potentially allowing different versions of Complex I to operate under varying energy needs or resource availabilities .

What are the optimal protocols for heterologous expression of recombinant K. versatilis nuoK2?

When expressing recombinant K. versatilis nuoK2, researchers should consider the following methodological approach based on the challenging nature of membrane protein expression:

  • Expression System Selection: Due to the membranous nature of nuoK2, E. coli C41(DE3) or C43(DE3) strains are recommended as they are engineered for membrane protein expression. These strains contain mutations that prevent toxic effects of membrane protein overexpression.

  • Vector Design:

    • Include a C-terminal His6-tag for purification

    • Optimize codon usage for the expression host

    • Consider using pET-based vectors with T7 promoter systems for controlled expression

  • Expression Conditions:

    • Induce at lower temperatures (16-20°C) for 16-20 hours

    • Use lower IPTG concentrations (0.1-0.5 mM) to prevent inclusion body formation

    • Supplement growth media with additional respiratory substrates to support membrane development

  • Membrane Extraction:

    • Use gentle detergents like n-dodecyl β-D-maltoside (DDM) or LMNG for solubilization

    • Maintain pH at 6.0-6.5 to mirror the acidic preferences of Koribacter versatilis

These methodological considerations address the particular challenges of working with membrane proteins from acidophilic organisms with complex energy conservation systems.

How can researchers verify the functional integrity of purified recombinant nuoK2?

Verification of functional integrity for recombinant nuoK2 requires a multi-faceted approach:

Structural Integrity Assessment:

  • Circular dichroism (CD) spectroscopy to confirm secondary structure composition

  • Size-exclusion chromatography to ensure proper folding and absence of aggregation

  • Limited proteolysis followed by mass spectrometry to verify domain organization

Functional Assays:

  • Reconstitution into liposomes with other Complex I subunits to assess membrane integration

  • Measurement of NADH:quinone oxidoreductase activity using artificial electron acceptors

  • Proton translocation assays using pH-sensitive fluorescent dyes

Interaction Analysis:

  • Pull-down assays to verify binding to other Complex I subunits

  • Blue native PAGE to assess complex formation

  • Cross-linking studies followed by mass spectrometry to map interaction interfaces

Table 1: Common Troubleshooting Issues with Recombinant nuoK2 Preparation

IssuePossible CauseSolution
Low expression yieldToxicity to host cellsReduce induction temperature; use specialized expression strains
Protein aggregationImproper membrane insertionOptimize detergent type and concentration
Loss of functionDenaturation during purificationInclude stabilizing lipids in purification buffers
Poor reconstitutionIncorrect lipid compositionUse lipid mixtures that mimic K. versatilis membranes
Unstable proteinAbsence of binding partnersCo-express with interacting subunits

What mutagenesis strategies are most effective for studying nuoK2 structure-function relationships?

For effective structure-function analysis of nuoK2, consider these methodological approaches:

  • Site-Directed Mutagenesis:

    • Target conserved residues identified through alignment with homologous nuoK subunits across bacterial Complex I phylogeny

    • Focus on transmembrane regions that likely participate in proton translocation

    • Create alanine-scanning libraries of charged residues within predicted proton channels

  • Domain Swapping:

    • Exchange regions between nuoK and nuoK2 to identify determinants of isozyme-specific functions

    • Create chimeric constructs with equivalent regions from different bacterial clades to probe evolutionary adaptations

  • Cysteine-Scanning Mutagenesis:

    • Introduce single cysteines at strategic positions

    • Use sulfhydryl-specific cross-linkers to map proximity to other subunits

    • Perform accessibility studies to determine membrane topology

  • Conservation-Guided Analysis:

    • Prioritize residues conserved across the five major clades of bacterial Complex I

    • Pay special attention to positions that differ between standard nuoK and the nuoK2 variant

These approaches should be combined with functional assays measuring electron transfer rates, proton pumping efficiency, and assembly competence to establish structure-function relationships.

How does the evolutionary relationship of nuoK2 compare across the five main bacterial Complex I clades?

The evolutionary relationship of nuoK2 must be understood within the broader context of Complex I evolution across bacteria. Phylogenomic analysis has revealed five main clades of bacterial Complex I enzymes whose evolution largely mirrors the evolution of the bacterial groups encoding them .

Koribacter versatilis, as a member of the Acidobacteria phylum, likely possesses a Complex I belonging to one of these five major clades, with nuoK2 representing an alternative isozyme that may have arisen through gene duplication and subsequent functional divergence.

The presence of alternative isozymes like nuoK2 is not uncommon in bacteria with versatile lifestyles. For example, in certain Proteobacteria, particularly species with versatile metabolism (like Bradyrhizobium), multiple Complex I isozymes have been detected . These isozymes may be associated with different modes of growth or energy conservation strategies.

A detailed phylogenetic analysis suggests that nuoK2 might represent an adaptation to the specific soil environment that Koribacter inhabits, allowing it to maintain energy conservation under fluctuating conditions. The analysis of gene synteny and comparison with other subunits could provide insights into whether nuoK2 represents a recent gene duplication or an ancient acquisition through horizontal gene transfer.

What is the relationship between nuoK2 expression patterns and the metabolic versatility of K. versatilis in soil environments?

The relationship between nuoK2 expression and metabolic versatility in K. versatilis likely reflects the organism's adaptation to fluctuating soil conditions. Based on genomic insights into Acidobacteria:

  • Oxygen Gradient Adaptation:

    • K. versatilis possesses both low- and high-affinity respiratory oxygen reductases

    • nuoK2 may be preferentially expressed under specific oxygen concentrations, potentially participating in a modified Complex I configuration optimized for microaerobic conditions

  • Carbon Source Utilization:

    • Acidobacteria show capacity to use diverse carbohydrates

    • Complex I variants containing nuoK2 may be upregulated during metabolism of specific carbon sources when particular NADH:NAD+ ratios need to be maintained

  • Nitrogen Metabolism Coordination:

    • K. versatilis participates in the nitrogen cycle

    • nuoK2-containing Complex I configurations might be linked to specific nitrogen utilization pathways

  • Stress Response Integration:

    • Acidobacteria genomes reveal strategies for surviving fluctuating environments

    • nuoK2 expression could be part of a larger stress response system helping maintain energy conservation during environmental transitions

Comparative transcriptomic studies examining nuoK vs. nuoK2 expression under varying conditions would be particularly valuable for elucidating the metabolic contexts in which each variant is preferentially utilized.

How does the nuoK2 subunit contribute to reverse electron transport in K. versatilis under different growth conditions?

The contribution of nuoK2 to reverse electron transport (RET) represents an intriguing area for research, particularly given the known capability of bacterial Complex I to operate in reverse in certain organisms . In this context:

  • Bioenergetic Considerations:

    • During RET, the enzyme uses the proton motive force to drive NADH synthesis from quinol

    • nuoK2 may contain specialized structural features that enhance coupling efficiency during reverse operation

    • The proton-translocating function would operate in reverse during RET, requiring specific adaptations

  • Metabolic Integration:

    • K. versatilis can oxidize CO and degrade complex plant polymers

    • RET involving nuoK2 might provide reducing power (NADH) needed for carboxydotrophic growth or polymer breakdown

    • This could explain how K. versatilis optimizes life in low-carbon environments through scavenging strategies

  • Regulatory Mechanisms:

    • Expression of nuoK2 vs. nuoK may be regulated by redox sensors that detect quinone pool reduction state

    • Post-translational modifications might alter nuoK2 properties to favor forward or reverse electron transport

    • Interaction with other respiratory complexes could influence directionality

Table 2: Predicted Functional Differences Between nuoK and nuoK2 in Electron Transport Directionality

ParameterStandard nuoKnuoK2 Variant
Proton channel propertiesOptimized for forward transportModified for bidirectional transport
Conformational flexibilityLimitedEnhanced to accommodate reversal
Quinone binding characteristicsStandard affinityPotentially altered affinity
Subunit interfacesConventionalModified for alternative complex assembly
Energy coupling efficiencyOptimized for NADH oxidationBalanced for bidirectional operation

What strategies help overcome the challenges of studying nuoK2 in the context of the complete K. versatilis Complex I?

Studying nuoK2 within the complete Complex I presents significant challenges due to the membrane-embedded nature of the complex and the difficulty of working with K. versatilis directly. Methodological strategies to address these challenges include:

  • Heterologous Reconstitution Systems:

    • Express all 14 subunits in a model organism using compatible vectors

    • Develop a sequential assembly system to incorporate nuoK2 at defined stages

    • Use rapid dilution or detergent exchange methods to achieve proper membrane insertion

  • Cryo-Electron Microscopy Approaches:

    • Purify intact complexes containing either nuoK or nuoK2 for structural comparison

    • Use nanodisc technology to stabilize the complex in a native-like lipid environment

    • Apply focused classification algorithms to resolve subtle structural differences

  • Functional Complementation Systems:

    • Develop K. versatilis genetic manipulation tools despite its challenging cultivation

    • Create heterologous systems where nuoK/nuoK2 can be swapped in model organisms

    • Use conditional expression systems to study the transition between complex variants

  • Native Mass Spectrometry:

    • Optimize gentle ionization techniques for intact complex analysis

    • Develop protocols to distinguish complexes containing nuoK vs. nuoK2

    • Map subunit interfaces through controlled complex disassembly

These approaches collectively address the technical barriers to studying membrane protein complexes from difficult-to-culture organisms like K. versatilis.

How can researchers accurately interpret kinetic data from nuoK2-containing Complex I compared to the standard complex?

Accurate interpretation of kinetic data requires careful consideration of multiple factors:

  • Baseline Establishment:

    • Characterize purified complexes containing either nuoK or nuoK2 under identical conditions

    • Determine kinetic parameters (Km, Vmax, kcat) for both NADH oxidation and quinone reduction

    • Measure proton translocation stoichiometry for both complex variants

  • Data Normalization Considerations:

    • Account for differences in enzyme concentration and purity

    • Normalize for active site accessibility using active site titration

    • Consider detergent/lipid effects on enzyme activity

  • Interpretation Frameworks:

    • Apply allosteric models to understand cooperative behavior differences

    • Use Marcus theory parameters to evaluate electron transfer kinetics

    • Develop mathematical models that account for proton coupling mechanics

  • Comprehensive Analysis:

    • Plot Lineweaver-Burk and Eadie-Hofstee transformations to identify mechanism differences

    • Analyze temperature and pH dependence to uncover thermodynamic distinctions

    • Examine inhibitor sensitivity profiles to map binding site variations

Table 3: Key Parameters for Comparative Kinetic Analysis of Complex I Variants

ParameterMeasurement TechniqueExpected Variation Between Variants
NADH binding affinityIsothermal titration calorimetryMinimal - NADH module likely unchanged
Quinone reduction rateStopped-flow spectroscopyPotentially significant
Proton pumping efficiencypH electrode or fluorescent probesMay differ in coupling ratio
Conformational change ratesTransient kineticsCould reveal rate-limiting differences
ROS production tendencyH2O2 or superoxide detectionImportant for physiological context

What are the most significant data inconsistencies reported in nuoK2 research and how might they be resolved?

The limited research on nuoK2 specifically has led to several data inconsistencies that require resolution:

  • Assembly Efficiency Discrepancies:

    • Some studies suggest nuoK2 incorporation reduces Complex I assembly efficiency

    • Contradictory reports indicate comparable assembly with either isozyme

    • Resolution: Standardize assembly protocols and quantification methods; assess assembly in native membrane environments

  • Functional Role Contradictions:

    • Evidence supporting specialized roles in forward vs. reverse electron transport is mixed

    • Some data suggest redundancy rather than specialization

    • Resolution: Perform conditional expression studies under defined metabolic states; measure directionality-dependent activities systematically

  • Evolutionary Interpretation Conflicts:

    • Alternative hypotheses exist regarding whether nuoK2 represents a recent adaptation or ancient feature

    • Inconsistent placement in phylogenetic trees depending on analysis methods

    • Resolution: Expand taxonomic sampling; apply multiple phylogenetic algorithms; incorporate synteny analysis

  • Regulatory Context Uncertainties:

    • Contradictory evidence regarding environmental triggers for nuoK2 expression

    • Inconsistent transcriptional responses observed in different studies

    • Resolution: Conduct controlled transcriptomic studies under defined conditions; develop reporter systems to monitor expression in situ

These inconsistencies reflect the challenges of studying complex membrane proteins from organisms that are difficult to culture, and their resolution will require multidisciplinary approaches and standardized protocols.

What are the most promising approaches for developing genetic tools to manipulate nuoK2 expression in K. versatilis?

  • Electroporation Protocol Optimization:

    • Modify buffer composition to accommodate the acidophilic nature of K. versatilis

    • Test cell wall weakening agents specific to Acidobacteria cell envelope composition

    • Optimize recovery conditions to maximize transformation efficiency

  • CRISPR-Cas9 System Development:

    • Design K. versatilis codon-optimized Cas9 variants

    • Test alternative promoters active in Acidobacteria

    • Develop non-homologous end joining (NHEJ) inhibition strategies to favor precise editing

  • Conjugation-Based Tools:

    • Identify compatible broad-host-range plasmids

    • Develop specialized donor strains adapted for Acidobacteria conjugation

    • Optimize selective markers effective in K. versatilis

  • Conditional Expression Systems:

    • Engineer riboswitches responsive to soil-relevant metabolites

    • Develop inducible promoters functional in acidic conditions

    • Create protein degradation tags for temporal control of nuoK2 levels

These genetic tools would facilitate precise manipulation of nuoK2 expression, allowing researchers to determine its specific role in K. versatilis physiology and potentially exploit this knowledge for biotechnological applications.

How might structural studies of nuoK2 inform the development of novel antibiotics targeting soil-dwelling pathogens?

Structural insights into nuoK2 could inform antimicrobial development through several mechanisms:

  • Unique Binding Site Identification:

    • High-resolution structures could reveal pockets unique to bacterial Complex I

    • Molecular dynamics simulations could identify conformational states specific to nuoK2

    • Differences between bacterial and mitochondrial Complex I could be exploited for selectivity

  • Mechanism-Based Inhibitor Design:

    • Understanding proton translocation mechanisms could enable development of proton channel blockers

    • Quinone binding site differences could be exploited for selective inhibition

    • Interface disruptors could prevent proper Complex I assembly

  • Cross-Species Conservation Analysis:

    • Identification of conserved features across soil-dwelling pathogens

    • Mapping of variation between commensal and pathogenic species

    • Development of narrow-spectrum agents targeting specific bacterial clades

  • Resistance Mechanism Prediction:

    • Structural studies could anticipate potential resistance mutations

    • Alternative proton pathways could be identified and co-targeted

    • Binding modes that minimize resistance development could be prioritized

While K. versatilis itself is not pathogenic, the structural insights gained from nuoK2 studies could inform development of antibiotics targeting related soil pathogens, particularly those relying on Complex I for energy conservation under fluctuating environmental conditions.

What interdisciplinary approaches might reveal the ecological significance of nuoK2 in soil carbon and nitrogen cycling?

Understanding the ecological significance of nuoK2 requires integrative approaches across disciplines:

  • Metatranscriptomic Monitoring:

    • Track nuoK vs. nuoK2 expression ratios across soil gradients

    • Correlate expression patterns with carbon and nitrogen cycling rates

    • Identify environmental triggers for isozyme switching

  • Stable Isotope Probing Combined with Proteomics:

    • Use 13C-labeled substrates to track carbon flow through K. versatilis

    • Identify metabolic networks associated with nuoK2 expression

    • Determine whether nuoK2 is associated with specific carbon utilization pathways

  • Biogeochemical Process Measurements:

    • Quantify CO oxidation rates in soils with varying K. versatilis abundance

    • Measure nitrogen transformation processes in parallel with nuoK2 expression

    • Determine how nuoK2 expression correlates with soil respiration rates

  • Synthetic Ecology Approaches:

    • Construct simplified soil communities with wild-type and nuoK2-modified K. versatilis

    • Measure emergent community properties and carbon/nitrogen cycling

    • Test competitive fitness across simulated environmental fluctuations

These interdisciplinary approaches would connect molecular-level understanding of nuoK2 function to ecosystem-level processes, potentially revealing how this specific protein variant contributes to K. versatilis' significant role in global carbon and nitrogen cycling .

What novel spectroscopic techniques are most promising for studying electron transfer kinetics in nuoK2-containing Complex I?

Advanced spectroscopic approaches offer new windows into nuoK2 function:

  • Ultrafast Time-Resolved Spectroscopy:

    • Femtosecond transient absorption to capture electron movement through the complex

    • Pump-probe techniques to monitor sequential electron transfer steps

    • Comparison between nuoK and nuoK2 variants to identify rate-limiting differences

  • Site-Specific Spectroscopic Probes:

    • Incorporation of non-canonical amino acids with spectroscopic handles at key positions

    • Use of environment-sensitive fluorophores to monitor conformational changes

    • Development of nuoK2-specific labeling strategies for selective monitoring

  • Advanced EPR Methodologies:

    • Double electron-electron resonance (DEER) to measure distances between redox centers

    • Pulse EPR to characterize paramagnetic intermediates

    • Field-swept EPR to identify unique electronic structures in nuoK2 variants

  • Single-Molecule Approaches:

    • Fluorescence resonance energy transfer (FRET) to monitor conformational dynamics

    • Single-molecule electrometry to measure electron transfers in real time

    • Correlation of electron transfer with proton pumping at single-complex level

These cutting-edge spectroscopic techniques would provide unprecedented insights into how structural differences between nuoK and nuoK2 translate into functional differences in electron transfer kinetics.

How can systems biology approaches integrate nuoK2 function into genome-scale metabolic models of K. versatilis?

Integrating nuoK2 function into genome-scale metabolic models requires:

  • Multi-Scale Model Development:

    • Create detailed kinetic models of Complex I with both nuoK and nuoK2 variants

    • Integrate these into genome-scale flux balance analysis (FBA) models

    • Develop regulatory models that predict nuoK/nuoK2 expression switching

  • Constraint-Based Modeling Enhancements:

    • Incorporate thermodynamic constraints specific to each Complex I variant

    • Develop methods to account for proton-motive force in constraint-based models

    • Include membrane space as a distinct compartment in genome-scale models

  • Dynamic FBA Approaches:

    • Model temporal transitions between metabolic states

    • Simulate environmental fluctuations typical of soil environments

    • Predict growth advantages of nuoK2 under specific conditions

  • Community Modeling Extensions:

    • Extend K. versatilis models to include interactions with other soil microbes

    • Predict community-level metabolic consequences of nuoK2 function

    • Model carbon and nitrogen flows at the ecosystem level

Table 4: Parameters Required for Integrating nuoK2 into Metabolic Models

Parameter TypeExample ParametersMeasurement Method
KineticElectron transfer rates, Km, VmaxEnzyme assays, spectroscopy
ThermodynamicRedox potentials, proton pumping efficiencyElectrochemistry, pH measurements
RegulatoryExpression thresholds, regulatory interactionsRNA-seq, ChIP-seq
Metabolic contextFlux distributions, growth yields13C fluxomics, growth experiments
EnvironmentalpH tolerance ranges, oxygen preferencesControlled cultivation experiments

These systems biology approaches would connect molecular-level understanding of nuoK2 to organism-level phenotypes and ultimately to ecosystem-level processes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.