Recombinant Koribacter versatilis Protein translocase subunit SecD (secD)

Shipped with Ice Packs
In Stock

Description

Role of SecD in the Sec Translocase System

SecD operates as part of the SecDF complex, which facilitates late-stage protein translocation by stabilizing substrate folding and maintaining proton motive force (PMF) . Key functions include:

  • Post-translocational substrate release: SecD assists in releasing translocated proteins from the SecYEG channel .

  • PMF utilization: It enhances translocation efficiency by coupling proton gradients to conformational changes in the translocon .

  • Cold sensitivity: SecD-deficient strains exhibit impaired growth and protein export at low temperatures .

In Gram-positive bacteria like Bacillus subtilis, SecD and SecF are fused into a single polypeptide (SecDF), suggesting functional co-dependence .

Production of Recombinant SecD

Recombinant SecD proteins are typically produced in E. coli with affinity tags for purification. For example:

  • Mycobacterium leprae SecD*: Expressed as a His-tagged protein in E. coli, yielding >90% purity .

  • Optimization strategies: Codon adaptation, low-temperature induction, and membrane protein-specific solubilization buffers are critical for stability .

Biotechnological Applications

Recombinant SecD homologs have been engineered to enhance protein secretion:

  • Enhanced secretion in B. subtilis: Co-expression of E. coli SecB with hybrid SecA increased alkaline phosphatase secretion by 300% .

  • Chaperone synergy: SecD collaborates with SecB and SecA to maintain substrate solubility and translocation competence .

Research Gaps and Future Directions

No direct studies on K. versatilis SecD exist, but comparative genomics suggests:

  • Gene organization: secD likely resides in an operon with secF or other translocon components .

  • Functional assays: Activity could be tested via PMF-dependent translocation assays using hybrid SecYEG-SecDF complexes .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery time estimates.
All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate this in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Please note that the tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
secD; Acid345_0146; Protein translocase subunit SecD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-535
Protein Length
full length protein
Species
Koribacter versatilis (strain Ellin345)
Target Names
secD
Target Protein Sequence
MKKNLTWKVVVIVAVLLVFAFGIIGNPAEVKWDKEGLKTALMNRIHLGLDLRGGTHLILQ VVVNDAVNAETDRAIERIKEDLANNKVTYSDITKPDAANAPERIAIKGITPDGATTLRRV SDERLPEYSFGSGPEGSYTLTMKPAQLKDLKDRAVQQAIQKIRERVDSLGVSEPVIQEHG LGDYQILVQLPGVDDPARVKEVMQSTAMLEIRQVFGGPYSKESEAAQGQMQQPDTVVLPG KSESDPGTQVFYLVARSSAVAGHDLRQARVGRDQNGGANVQFNLTRDGGVRFSQFTSAHV GDKLGVILDGKVMEVANIKSEISDSGEIEGRFTDQQASDLALILNSGALPASIKYLEERT VGPSLGMDSIRQGVRAAIIGFVAVIIFMLIYYKGAGINADLSLLLNLVILLGFMGYFGAV LTLPGIAGVILTVGMGVDSNVLIFERIREELRNGKTPPSAVEQGFGHAWLTIIDTHVTTI VSAIILFLFGTGPVKGFAVTLSFGLFANLFTAVFVSRVIFDSILNRHQRGEALSI
Uniprot No.

Target Background

Function
SecD is a component of the Sec protein translocase complex. It interacts with the SecYEG preprotein conducting channel. SecDF utilizes the proton motive force (PMF) to complete protein translocation after the ATP-dependent function of SecA.
Database Links
Protein Families
SecD/SecF family, SecD subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Koribacter versatilis and why is it significant for protein secretion research?

Candidatus Koribacter versatilis is a member of the Acidobacteria phylum, classified within Subdivision 1. Acidobacteria are ubiquitous soil bacteria with remarkable phylogenetic diversity comparable to Proteobacteria, spanning 26 subdivisions . Despite their abundance in soil environments (constituting up to 40% of soil bacterial communities), they remain challenging to study due to cultivation difficulties .

K. versatilis has been characterized as a versatile heterotroph that grows optimally at low pH and produces substantial extracellular material . Its genome reveals adaptation to fluctuating nutrient environments through diverse carbohydrate utilization pathways and various inorganic and organic nitrogen source processing mechanisms . The SecD protein from K. versatilis represents an important component of the bacterial protein secretion machinery that may contribute to this organism's ecological success through efficient protein translocation across the membrane.

What is the function of SecD in bacterial protein translocation?

SecD functions as a critical accessory subunit in the bacterial Sec translocase complex, which facilitates protein secretion and membrane protein insertion. The SecD protein specifically assists in the later stages of protein translocation, working in conjunction with SecF to enhance the release of proteins from the translocase and improve the efficiency of the secretion process.

In the context of Acidobacteria like K. versatilis, efficient protein secretion systems likely contribute to their ecological adaptability by enabling the export of extracellular enzymes for nutrient acquisition. Genomic analyses have revealed that many Acidobacteria strains produce copious amounts of extracellular material and possess both low-specificity major facilitator superfamily and high-affinity ABC-type transporters . The SecD protein would play an essential role in facilitating the export of proteins that comprise this extracellular matrix and enzymes that enable versatile metabolic capabilities.

How reliable is the current structural data for K. versatilis SecD?

A computed structure model of K. versatilis SecD (UniProtKB: Q1IVE9) has been generated and is available in the AlphaFold database (AF-Q1IVE9-F1) . This model was released on December 9, 2021, and subsequently updated on September 30, 2022 . The model demonstrates a relatively high confidence score with a global pLDDT (predicted Local Distance Difference Test) value of 85.9, placing it in the "confident" prediction category (70 < pLDDT ≤ 90) .

It's important to note that this is a computed structure model without experimental verification through methods such as X-ray crystallography or cryo-electron microscopy. While AlphaFold predictions generally provide reliable structural insights, especially for regions with high confidence scores, researchers should approach certain structural features with appropriate caution, particularly those with lower local pLDDT values that may indicate flexible or disordered regions.

What expression systems are most effective for recombinant K. versatilis SecD production?

A strategy demonstrated to be effective for other challenging membrane proteins involves the use of fusion tags to improve solubility. For instance, in work with related proteins, researchers found that fusion with maltose-binding protein (MBP) substantially enhanced soluble protein yield . When expressing the phenylacetate decarboxylase (PhdB) protein from an Acidobacteria strain, investigators found that "a maltose-binding protein (MBP) tag was used to improve protein solubility" . This approach could be adapted for K. versatilis SecD expression.

The expression construct design should incorporate:

  • A strong but controllable promoter (e.g., T7)

  • N-terminal fusion tags such as His6-MBP with a TEV protease cleavage site

  • Codon optimization for the expression host

  • Careful temperature control during induction (typically lower temperatures of 16-20°C)

What purification approaches overcome the challenges associated with membrane protein isolation?

Purification of membrane proteins like K. versatilis SecD requires specialized approaches:

  • Detergent Screening: Systematic testing of various detergents (e.g., DDM, LDAO, or CHAPS) to identify optimal conditions for SecD extraction while maintaining native conformation.

  • Two-Step Affinity Purification: Utilizing the dual-tagging system (e.g., His6-MBP-SecD) for sequential purification:

    • Initial capture via immobilized metal affinity chromatography (IMAC)

    • Subsequent purification using amylose resin to capture the MBP tag

    • Optional TEV protease treatment to remove tags if required for functional studies

  • Size Exclusion Chromatography: Final polishing step to isolate properly folded, homogeneous protein and remove aggregates.

This approach mirrors successful strategies used for other challenging membrane proteins, where tags like MBP have significantly improved recombinant protein solubility . Protein quality should be assessed at each purification step using SDS-PAGE, western blotting, and activity assays where applicable.

How can researchers assess and optimize the folding of recombinant K. versatilis SecD?

Proper folding assessment of K. versatilis SecD requires multiple complementary approaches:

Thermal Stability Assays: Differential scanning fluorimetry (DSF) using environment-sensitive dyes can evaluate protein stability under various buffer conditions, detergents, and ligands.

Circular Dichroism (CD) Spectroscopy: This technique provides information about secondary structure content, which can be compared to predictions based on the AlphaFold structural model (pLDDT global score: 85.9) .

Limited Proteolysis: Correctly folded proteins typically show resistance to proteolytic digestion compared to misfolded variants, producing characteristic fragment patterns.

Functional Reconstitution: Though challenging, reconstitution of SecD into liposomes or nanodiscs followed by functional assays provides the most definitive evidence of proper folding.

Optimization strategies may include:

  • Testing various detergents and lipids

  • Addition of specific phospholipids during purification

  • Expression at reduced temperatures

  • Co-expression with chaperone proteins

  • Use of disulfide bond isomerases for proper disulfide bond formation where applicable

What are the key structural domains of K. versatilis SecD and their predicted functions?

Analysis of the AlphaFold-predicted structure of K. versatilis SecD (UniProtKB: Q1IVE9) reveals several characteristic domains that align with the general architecture of bacterial SecD proteins :

  • Transmembrane Domain: Multiple membrane-spanning helices anchor the protein in the cytoplasmic membrane and form part of the protein-conducting channel.

  • Periplasmic Domain: A large extracellular domain likely functions in substrate recognition and processing.

  • P1 Head Domain: This domain typically exhibits a β-barrel structure and is thought to interact with translocating proteins.

  • P1 Base Domain: Connects the P1 head to the transmembrane regions and may be involved in conformational changes during protein translocation.

The confidence score of the AlphaFold model (pLDDT global: 85.9) suggests a reliable prediction for most of the protein structure , though experimental validation through techniques like cryo-EM or X-ray crystallography would provide more definitive structural information.

How can researchers design functional assays to evaluate K. versatilis SecD activity?

Designing functional assays for K. versatilis SecD presents unique challenges due to its role as part of a multi-protein complex. Researchers can employ several complementary approaches:

Complementation Assays:

  • Engineer SecD-deficient E. coli strains with temperature-sensitive growth phenotypes

  • Transform with K. versatilis SecD and assess restoration of growth at non-permissive temperatures

  • Measure secretion of reporter proteins in the complemented strains

Reconstituted Translocation Systems:

  • Purify individual components of the Sec translocase, including K. versatilis SecD

  • Reconstitute the complex in proteoliposomes

  • Measure translocation of fluorescently labeled substrate proteins across the membrane

  • Compare translocation efficiency in the presence and absence of SecD

ATP Hydrolysis Assays:

  • While SecD itself is not an ATPase, it modulates the ATPase activity of SecA

  • Measure SecA ATPase activity in the presence and absence of purified K. versatilis SecD

  • Quantify the enhancement of ATPase activity as an indicator of functional SecD

Protein-Protein Interaction Studies:

  • Use techniques like pull-down assays, surface plasmon resonance, or isothermal titration calorimetry

  • Quantify interactions between K. versatilis SecD and other Sec translocase components

  • Map interaction interfaces using mutagenesis studies

What role might SecD play in the ecological adaptation of K. versatilis to soil environments?

K. versatilis, like other Acidobacteria, demonstrates remarkable ecological adaptability in soil environments, and the SecD protein likely contributes significantly to this success through several mechanisms:

Efficient Protein Secretion for Nutrient Acquisition: Acidobacteria are known to produce copious amounts of extracellular material and possess diverse pathways for carbohydrate utilization and nitrogen source processing . The SecD component of the Sec translocase would facilitate efficient export of hydrolytic enzymes for breakdown of complex soil organic matter.

Adaptation to Fluctuating Environmental Conditions: Soil environments experience rapid changes in moisture, temperature, and nutrient availability. K. versatilis has been identified as having genomic, physiological, and metabolic versatility that provides flexibility in such variable conditions . The SecD protein may contribute to rapid adaptation by ensuring efficient membrane protein insertion and secretion of stress-response proteins.

Biofilm Formation and Community Interactions: The extensive extracellular material produced by Acidobacteria suggests involvement in biofilm formation. SecD-mediated secretion of extracellular polymeric substances could facilitate attachment to soil particles and interactions with other microorganisms in the soil microbiome.

pH Adaptation: As K. versatilis is adapted to low pH environments , its SecD protein may have evolved specific features to maintain functionality under acidic conditions, potentially through modified proton-motive force coupling mechanisms.

How can comparative genomics of SecD across Acidobacteria inform evolutionary adaptations?

Comparative genomic analysis of SecD across the Acidobacteria phylum offers valuable insights into evolutionary adaptations of this secretion system component:

Conservation Analysis:
Examination of SecD sequence conservation across the 26 subdivisions of Acidobacteria could reveal:

  • Core functional domains with high conservation indicating essential functions

  • Variable regions that may reflect adaptation to specific ecological niches

  • Lineage-specific insertions or deletions that might confer specialized functions

Correlation with Genomic Features:
Researchers can correlate SecD variations with other genomic features:

  • Genome size and gene content variation across Acidobacteria (which spans from 2.0 to 9.9 Mb)

  • Presence of mobile genetic elements and prophages that shape genome plasticity

  • Coevolution with other components of the Sec translocase complex

Phylogenetic Profiling:
Analysis of the co-occurrence patterns of SecD variants with specific metabolic pathways or stress response mechanisms could illuminate adaptive strategies. For instance, particular SecD variants might correlate with specialized secretion capabilities supporting unique ecological adaptations.

This approach could help explain why, despite phylogenetic similarities (e.g., 95% 16S rRNA identity), the proteomes of related Acidobacteria can exhibit substantial differences, as seen between Acidobacteria strain Tolsyn and Ca. Koribacter versatilis (approximately 56% average protein sequence identity) .

What CRISPR-based strategies might overcome challenges in genetic manipulation of K. versatilis?

Genetic manipulation of Acidobacteria including K. versatilis has been notoriously challenging , limiting functional genomics studies. CRISPR-based approaches offer promising solutions:

Optimized CRISPR-Cas9 System for Acidobacteria:

  • Codon-optimize Cas9 for K. versatilis based on its unique codon usage patterns

  • Utilize promoters native to Acidobacteria for reliable expression

  • Design guide RNAs accounting for the high AT-content typical of many Acidobacteria genomes

  • Incorporate temperature-sensitive origins of replication suited to K. versatilis' growth conditions

In vivo Expression Analysis:

  • Design reporter systems using secreted proteins fused to fluorescent or luminescent tags

  • Express wild-type and mutant versions of SecD to assess impact on protein secretion

  • Quantify effects on growth, stress response, and secretion phenotypes

CRISPR Interference (CRISPRi) Approach:

  • Employ catalytically inactive Cas9 (dCas9) to reversibly repress SecD expression

  • Create an inducible system to titrate SecD levels and assess threshold effects

  • Combine with RNA-seq to identify compensatory mechanisms activated during SecD depletion

Base Editing and Prime Editing:
These precise editing technologies could introduce specific mutations in SecD without requiring double-strand breaks, potentially increasing editing efficiency in this challenging organism.

How might structural studies of K. versatilis SecD inform antimicrobial development?

The Sec translocase represents a promising but underexplored target for antimicrobial development. Structural studies of K. versatilis SecD could inform this field in several ways:

Novel Binding Site Identification:
The AlphaFold model of K. versatilis SecD (pLDDT global: 85.9) provides a starting point for computational identification of potential inhibitor binding sites, particularly at:

  • Interfaces between SecD and other Sec components

  • ATP binding regulatory regions

  • Substrate protein interaction surfaces

  • Conserved functional domains unique to bacterial Sec systems

Structure-Based Virtual Screening:

  • Use the SecD structural model to conduct in silico screening of compound libraries

  • Identify compounds that theoretically bind to critical functional sites

  • Validate through biochemical assays and crystallographic studies

  • Optimize lead compounds for increased specificity and potency

Targeting Acidobacteria-Specific Features:
Comparative analysis might reveal structural features unique to Acidobacteria SecD proteins that could allow development of narrow-spectrum antimicrobials targeting this specific phylum.

Resistance Mechanism Prediction:
Structural knowledge enables prediction of potential resistance mutations and preemptive design of inhibitors less susceptible to resistance development.

This approach is particularly valuable considering the ecological importance of Acidobacteria in soil ecosystems and the need for targeted rather than broad-spectrum antimicrobials for agricultural applications.

What experimental design effectively addresses solubility challenges with recombinant K. versatilis SecD?

Membrane proteins like SecD typically present significant solubility challenges during recombinant expression. A systematic experimental approach includes:

Fusion Tag Optimization Matrix:

Tag SystemExpression VectorHost StrainInduction ConditionsExpected Outcome
His6-MBP-TEVpET28bBL21(DE3)18°C, 0.1mM IPTG, overnightHigh solubility, facilitates purification
His6-SUMOpET SUMOBL21(DE3) pLysS25°C, 0.5mM IPTG, 4 hoursEnhanced folding, protease removal of tag
His6-TrxApET32aOrigami B(DE3)16°C, 0.2mM IPTG, overnightDisulfide bond formation assistance
His6-NusApET43aC41(DE3)20°C, 0.3mM IPTG, 6 hoursImproved solubility for large proteins

Detergent Screening Protocol:

  • Express SecD using optimal fusion system (e.g., His6-MBP-SecD)

  • Divide cell lysate into equal aliquots

  • Extract with different detergents (DDM, LDAO, FC-12, CHAPS)

  • Analyze soluble fraction by western blot

  • Assess protein quality via size exclusion chromatography

This systematic approach mirrors successful strategies used with other challenging proteins from Acidobacteria, where MBP fusion tags significantly improved recombinant protein solubility . The experimental design should include appropriate controls and statistical analysis to ensure reproducibility.

How can researchers optimize co-expression studies to investigate SecD interactions with other Sec translocase components?

Investigating protein-protein interactions within the Sec translocase complex requires carefully designed co-expression systems:

Multi-Plasmid Co-Expression System:

  • Primary plasmid: K. versatilis SecD with affinity tag (e.g., His6)

  • Secondary plasmid: Potential interaction partner (e.g., SecF) with different tag (e.g., FLAG)

  • Use plasmids with compatible origins and different antibiotic resistance markers

  • Employ promoters with similar strength or inducible systems

Sequential Pulldown Assay Protocol:

  • Co-express SecD and potential partners in E. coli

  • Lyse cells and solubilize membrane fraction with optimized detergent

  • Perform first affinity purification via His6 tag

  • Analyze co-purifying proteins by western blot with anti-FLAG antibody

  • Perform second affinity purification using FLAG tag

  • Confirm reciprocal interaction by western blot with anti-His antibody

Controls and Validation:

  • Negative control: Express SecD with unrelated membrane protein

  • Positive control: Co-express well-established interacting proteins

  • Competition assay: Add purified untagged protein to disrupt specific interactions

  • Crosslinking studies to capture transient interactions

This approach provides robust evidence for specific protein-protein interactions while minimizing false positives from non-specific binding to affinity resins or hydrophobic interactions between membrane proteins.

What are the optimal methods for analyzing SecD contribution to protein secretion in reconstituted systems?

To rigorously assess K. versatilis SecD function in protein secretion, reconstituted systems offer the most controlled experimental environment:

Proteoliposome Reconstitution Protocol:

  • Purify individual Sec components (SecYEG, SecA, SecDF-YajC)

  • Prepare liposomes with E. coli polar lipid extract

  • Incorporate purified Sec components via detergent-mediated reconstitution

  • Remove detergent using Bio-Beads or dialysis

  • Verify incorporation by density gradient centrifugation and western blot

Translocation Assay Design:

  • Substrate: Purified unfolded preprotein with C-terminal fluorescent label

  • Reaction components: ATP, SecA, reconstituted proteoliposomes

  • Assay variations: With and without SecDF-YajC to assess contribution

  • Detection: Protease protection of translocated fluorescent domain

  • Quantification: Fluorescence spectroscopy or SDS-PAGE with fluorescence imaging

Advanced Analysis Methods:

  • Real-time translocation kinetics using FRET-based reporters

  • Single-molecule studies to observe individual translocation events

  • Electron microscopy of reconstituted complexes to visualize structural arrangements

This methodological approach allows precise quantification of SecD contribution to translocation efficiency, substrate specificity, and energy coupling during the secretion process.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.