Recombinant Koribacter versatilis Protein translocase subunit SecF (secF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order. We will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
secF; Acid345_0147; Protein translocase subunit SecF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-404
Protein Length
full length protein
Species
Koribacter versatilis (strain Ellin345)
Target Names
secF
Target Protein Sequence
MELFRNTNIDFLGKKWYFLAFSLVFSVAGLISMGARYAKTGTAVPLGVDFKGGTLVYVKF AQTPNLGDIRAAMDRSGLKDPKIQTYGGPANNEVLIALEQKETSEQALDAGKNTIIKALE TNPASGKNDLNNVGSTTIRDYLMSKDPLHEVVDPGAKYQQIASQIVDYRDKERGGVLSSV DELQGHVPADVVNALKTDYFTSGFGVRNVEIVGPQVGKQLSNQALLATLYSLGGMLVYLW FRFELIYGIGAVVACFHDTIITVGAFSLLNRDISLTVVAAILTLIGYSMNDTIVVYDRIR ENIKLLRRESLADIVNKSINQTLSRTILTSGLTFLTVLSLYVFGGEVLRGFSLALVIGIL IGTYSSIAVAAPMLVAYQEWRGHRGTAALPGPAPRKNDRVKVKA
Uniprot No.

Target Background

Function
SecF is a component of the Sec protein translocase complex. It interacts with the SecYEG preprotein conducting channel. SecDF utilizes the proton motive force (PMF) to complete protein translocation after the ATP-dependent function of SecA.
Database Links
Protein Families
SecD/SecF family, SecF subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Koribacter versatilis SecF protein and what is its function?

Koribacter versatilis SecF is a subunit of the protein translocase complex that plays a critical role in bacterial protein export systems. As part of the SecDF complex, it functions as a translocation factor that enhances polypeptide secretion driven by the Sec translocase, which consists of the translocon SecYEG and ATPase SecA . The SecDF complex is believed to utilize the proton gradient across the bacterial membrane to effectively pull precursor proteins from the cytoplasm into the periplasm . In Koribacter versatilis (strain Ellin345), the SecF protein consists of 404 amino acids and is encoded by the secF gene (also known as Acid345_0147) .

How is Koribacter versatilis taxonomically classified within Acidobacteria?

Koribacter versatilis belongs to the bacterial phylum Acidobacteria, which is one of the dominant bacterial phyla found in various environments. Acidobacteria is part of a core bacterial community that typically includes Proteobacteria, Actinobacteria, Firmicutes, Verrucomicrobia and Planctomycetes in many soil environments . K. versatilis (strain Ellin345) has been specifically studied for its genetic capabilities, including the synthesis of hopanoids and related biosynthetic pathways . Within the Acidobacteria phylum, different subdivisions (SDs) are recognized, and K. versatilis belongs to a subdivision that possesses specific genetic capabilities for hopanoid biosynthesis, distinguishing it from other Acidobacteria subdivisions .

What are the optimal storage conditions for recombinant K. versatilis SecF protein?

Based on product specifications, recombinant K. versatilis SecF protein should be stored at -20°C, but for extended storage, conservation at -80°C is recommended . The protein should be kept in an appropriate storage buffer, typically a Tris-based buffer with 50% glycerol or Tris/PBS-based buffer with 6% Trehalose at pH 8.0, optimized for this specific protein .

It is important to note that repeated freezing and thawing is not recommended as it can degrade the protein structure and function. For ongoing experiments, working aliquots can be stored at 4°C for up to one week . When preparing the protein for long-term storage, it's advisable to add glycerol (final concentration of 5-50%, with 50% being commonly used) and divide the solution into small aliquots to minimize freeze-thaw cycles .

How should recombinant K. versatilis SecF protein be reconstituted for experimental use?

For optimal reconstitution of lyophilized recombinant K. versatilis SecF protein:

  • Briefly centrifuge the vial prior to opening to bring the contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (typically 50% is recommended)

  • Aliquot the reconstituted protein for long-term storage at -20°C/-80°C

This reconstitution protocol helps maintain protein integrity while providing convenient access for experimental procedures. The addition of glycerol acts as a cryoprotectant to prevent protein denaturation during freeze-thaw cycles.

What expression systems are commonly used for producing recombinant K. versatilis SecF?

Recombinant K. versatilis SecF protein is commonly expressed in E. coli expression systems. According to the product information, the full-length protein (amino acids 1-404) fused to an N-terminal His tag has been successfully expressed in E. coli . This expression system provides several advantages:

  • High yield of target protein

  • Established protocols for induction and purification

  • Compatibility with affinity tags (such as His-tag) for simplified purification

  • Ability to express full-length membrane proteins

The choice of E. coli as an expression host facilitates downstream purification processes, particularly when the recombinant protein incorporates affinity tags like the His-tag mentioned in the product specifications .

How does the structure of SecDF contribute to its function in protein translocation?

The SecDF complex functions as a critical component of the bacterial Sec system, enhancing protein translocation efficiency. Based on research using atomic force microscopy (AFM), SecDF exhibits different conformational states that are integral to its function . In isolation, SecDF adopts a stable and compact conformation close to the lipid bilayer surface, which is indicative of a resting state .

Interestingly, when SecYEG (another component of the Sec translocase) is introduced, significant changes occur in both SecDF conformation and conformational dynamics . This suggests that SecDF undergoes structural transitions during the protein translocation process that are influenced by interactions with other components of the Sec machinery.

The SecDF complex is thought to utilize the proton motive force (PMF) to enhance protein translocation. The current model suggests that SecDF uses the energy from the proton gradient to effectively "pull" precursor proteins from the cytoplasm into the periplasm, working in concert with the pushing force provided by SecA-ATP hydrolysis . These conformational changes observed through AFM likely represent different stages in this PMF-driven translocation enhancement process.

How might the membrane topology of SecF influence its function in K. versatilis?

The SecF protein in K. versatilis, like other bacterial SecF proteins, is an integral membrane protein with multiple transmembrane domains as suggested by its amino acid sequence . The membrane topology of SecF is critical to its function in protein translocation for several reasons:

  • Periplasmic protrusions: AFM studies have shown that SecDF exhibits protrusions that can be visualized in supported lipid bilayers, suggesting that these membrane-external domains play a role in the conformational changes associated with protein translocation .

  • Proton channel formation: As SecDF utilizes the proton gradient to drive protein translocation, the transmembrane domains likely form a channel that allows protons to move across the membrane, coupling this energy to the mechanical work of protein translocation .

  • Interaction with SecYEG: The introduction of SecYEG causes changes in SecDF conformation and dynamics , suggesting that specific regions of the SecF topology are involved in protein-protein interactions with other components of the Sec machinery.

  • Substrate interaction sites: The membrane topology creates specific substrate interaction sites that allow SecDF to engage with translocating polypeptides and facilitate their movement across the membrane.

Understanding the detailed membrane topology of K. versatilis SecF would provide insights into how this protein contributes to the bacterium's protein secretion capabilities in its natural ecological context.

What single-case experimental designs (SCEDs) would be appropriate for studying the function of K. versatilis SecF?

Single-case experimental designs (SCEDs) provide a rigorous methodology for studying the effects of specific interventions or manipulations . For studying K. versatilis SecF function, several SCED approaches could be appropriate:

  • Multiple baseline design: This approach could be used to study the effect of SecF on translocation of different protein substrates, introducing the SecF protein at different time points for each substrate.

  • Reversal (ABAB) design: This design would involve alternating between conditions with and without functional SecF (perhaps using temperature-sensitive mutants or inhibitors) to demonstrate the causal relationship between SecF activity and translocation efficiency.

  • Changing criterion design: By systematically varying conditions (e.g., proton gradient strength), researchers could establish how different parameters affect SecF function.

When implementing these designs, researchers should ensure adequate baseline sampling and appropriate methods of analysis as highlighted in contemporary standards for SCED research . The systematic review of SCED studies published between 2000 and 2010 found that analytic method was an area of discord, suggesting that researchers should carefully consider and justify their analytical approaches .

What techniques are most effective for studying SecDF conformational dynamics?

Based on the search results, atomic force microscopy (AFM) has proven to be a particularly effective technique for studying SecDF conformational dynamics . The advantages of this approach include:

  • Single-molecule resolution: AFM allows visualization of individual SecDF complexes, providing insights that might be lost in ensemble measurements.

  • Near-native conditions: AFM can study membrane proteins in supported lipid bilayers, maintaining a more physiologically relevant environment than many other structural techniques .

  • Temporal resolution: The ability to acquire kymographs with ~100 ms resolution allows researchers to track conformational changes in real time .

  • Direct access to membrane-external conformations: The sharp tip of the AFM provides direct access to membrane-external protein conformations, which is particularly valuable for studying periplasmic domains of SecDF .

When applying AFM to study K. versatilis SecF, researchers should consider:

  • Comparing experimental AFM images to simulated AFM images based on static structures

  • Examining SecF both in isolation and in the presence of other Sec components like SecYEG

  • Manipulating conditions such as the proton gradient to observe effects on conformational dynamics

  • Combining AFM with complementary techniques such as FRET or EPR spectroscopy to obtain a more complete picture of protein dynamics

How can researchers address potential artifacts in membrane protein reconstitution when studying K. versatilis SecF?

When reconstituting membrane proteins like K. versatilis SecF for functional or structural studies, several potential artifacts can arise that might affect experimental outcomes. Researchers should consider the following approaches to address these challenges:

  • Lipid composition optimization:

    • Test multiple lipid compositions that mimic the native membrane environment of K. versatilis

    • Compare protein activity and conformational states across different lipid environments

    • Consider using lipid extracts from Acidobacteria to provide a more native-like environment

  • Protein orientation control:

    • Develop methods to ensure uniform orientation of SecF in reconstituted systems

    • Use oriented reconstitution techniques such as directed insertion into preformed liposomes

    • Verify orientation using accessibility assays with membrane-impermeable reagents

  • Functional validation:

    • Establish functional assays to confirm that reconstituted SecF retains native activity

    • Compare the activity of reconstituted protein to that observed in native membrane preparations

    • Use multiple complementary assays to validate functionality

  • Detergent effects mitigation:

    • Screen multiple detergents for protein extraction and purification

    • Minimize detergent exposure time during reconstitution

    • Consider detergent-free methods such as styrene-maleic acid lipid particles (SMALPs)

  • Quality control measures:

    • Implement rigorous quality control of protein samples using techniques like SEC-MALS, native PAGE, and negative stain EM

    • Assess protein homogeneity and aggregation state before reconstitution

    • Document batch-to-batch variation and establish acceptance criteria

By systematically addressing these potential artifacts, researchers can increase confidence that their observations reflect the true properties of K. versatilis SecF rather than experimental artifacts.

How should researchers interpret contradictory findings about SecF function between different experimental systems?

When faced with contradictory findings about SecF function across different experimental systems, researchers should adopt a systematic approach to reconciliation:

  • Evaluate methodological differences:

    • Compare protein preparation methods (e.g., tags, expression systems, purification protocols)

    • Assess differences in membrane mimetics (detergents, lipid compositions, nanodiscs)

    • Consider differences in assay conditions (pH, temperature, salt concentration)

  • Consider species-specific variations:

    • Acknowledge that K. versatilis SecF may function differently than SecF from model organisms

    • Compare sequence homology and structural predictions between the SecF proteins being studied

    • Evaluate the ecological context of different species and how this might influence SecF function

  • Integrate multiple lines of evidence:

    • Weight findings based on methodological rigor and proximity to native conditions

    • Look for consensus across different experimental approaches

    • Develop testable hypotheses that could explain apparent contradictions

  • Design discriminating experiments:

    • Create experimental designs specifically aimed at resolving contradictions

    • Use chimeric proteins or site-directed mutagenesis to identify critical regions responsible for functional differences

    • Apply single-case experimental designs that can rigorously test causality in specific contexts

  • Construct integrative models:

    • Develop models that can accommodate seemingly contradictory findings

    • Consider whether contradictions might reflect different states or conditions of a dynamic system

    • Use computational approaches to test whether models can reproduce experimental observations

By applying this framework, researchers can transform contradictory findings from a source of confusion into valuable insights about the context-dependent function of SecF.

What statistical approaches are most appropriate for analyzing SecF conformational dynamics data?

When analyzing data on SecF conformational dynamics, particularly from techniques like atomic force microscopy , researchers should consider these statistical approaches:

  • Time series analysis:

    • Hidden Markov Models (HMMs) to identify discrete conformational states from continuous measurements

    • Autocorrelation analysis to identify characteristic timescales of conformational changes

    • Wavelet analysis to detect transient or non-stationary dynamics

  • Distribution analysis:

    • Kernel Density Estimation (KDE) for non-parametric visualization of conformational distributions

    • Mixture models to identify and characterize multiple conformational populations

    • Kolmogorov-Smirnov or Anderson-Darling tests to compare distributions between experimental conditions

  • Transition analysis:

    • Transition path theory to analyze pathways between conformational states

    • Dwell time analysis to determine kinetic parameters of state transitions

    • Markov State Models (MSMs) to build predictive models of conformational dynamics

  • Correlation with functional data:

    • Regression analyses to correlate conformational parameters with functional measurements

    • Information theory approaches to quantify mutual information between conformational states and functional outcomes

    • Causal inference methods to establish relationships between conformational changes and function

  • Validation approaches:

    • Cross-validation to ensure statistical models are not overfitted

    • Bootstrap resampling to estimate confidence intervals

    • Simulation studies to validate analytical methods with synthetic data where ground truth is known

Researchers should select methods appropriate to their specific experimental design and data characteristics, while being aware of the strengths and limitations of each approach. As noted in the review of single-case experimental designs, the choice of analytic method is an area that requires careful consideration .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.