Recombinant Koribacter versatilis Sec-independent protein translocase protein TatC (tatC)

Shipped with Ice Packs
In Stock

Description

Definition and Overview

Recombinant Koribacter versatilis Sec-independent protein translocase protein TatC (tatC) is a purified, recombinant form of the integral membrane protein TatC, produced in a heterologous expression system. It is a core component of the twin-arginine translocation (Tat) pathway, which translocates folded proteins across bacterial membranes. This recombinant variant is derived from the K. versatilis strain Ellin345 and is characterized by its unique amino acid sequence (Uniprot: Q1IN69).

Key Features:

AttributeDetails
SpeciesKoribacter versatilis (strain Ellin345)
GenetatC
Uniprot IDQ1IN69
Expression Region1–271 amino acids (full-length)
Storage BufferTris-based buffer, 50% glycerol (optimized for stability)
Storage Conditions-20°C (long-term), 4°C (working aliquots for ≤1 week)

Functional Role in Protein Translocation

TatC serves as the receptor for the Tat pathway, binding substrates and recruiting TatA/TatB components to form a translocation-competent complex.

Mechanistic Overview:

  1. Substrate Binding: TatC recognizes N-terminal twin-arginine motifs in folded substrates via its hydrophilic domains .

  2. TatA/TatB Recruitment: Forms a receptor complex with TatB (resting state) or TatA (activated state), triggering oligomerization of TatA to create a translocation channel .

  3. Membrane Integration: The transmembrane helices anchor TatC to the membrane, facilitating proton motive force-dependent transport .

Recombinant Applications:

  • ELISA Assays: Used as an antigen to detect anti-TatC antibodies in research or diagnostic settings .

  • Biochemical Studies: Investigates substrate binding kinetics, receptor assembly, or interactions with other Tat components .

Research Findings and Challenges

Key Insights:

  • Stability Requirements: Native TatC requires TatB for stability; recombinant production may bypass this dependency through optimized buffers (e.g., 50% glycerol) .

  • Functional Specificity: Truncation studies in E. coli TatC suggest the C-terminal region is dispensable for receptor assembly but critical for quality control .

Limitations:

  • Activity in Isolation: Recombinant TatC may lack functional activity without co-expressed TatA/B, limiting utility in reconstitution assays .

  • Species-Specific Variations: Structural divergence from E. coli or Aquifex homologs may affect substrate specificity or efficiency .

Applications in Research and Biotechnology

ApplicationDescription
Structural BiologyCrystallization studies to resolve membrane organization and substrate docking.
Therapeutic TargetingScreening for Tat pathway inhibitors in pathogenic bacteria (e.g., Pseudomonas) .
BioproductionEngineering secretion systems for recombinant protein production in industrial microbes.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
tatC; Acid345_2680; Sec-independent protein translocase protein TatC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-271
Protein Length
full length protein
Species
Koribacter versatilis (strain Ellin345)
Target Names
tatC
Target Protein Sequence
MPSPTIDPAIRARLSQEALKGMSFLEHLEELRRRIIWTFVYIAAGFGVCWWWHEQIYDFM QRPIMKALAANHLDQKLVYLNPTEPFNMYLKMAFIAGLFVASPFVLYQVWLFIAPGLYKR ERRYVLPFMFSTVLLFLGGGVFGYYMVYPNALTFLIGYSHQFSPMITISEYTDLFLTIIL GLGIVFEMPILVFFLALMGIVSAGWMWRNLRYSILVIFVIAAIITPTTDIMNMCVFAAPM ILLYILSIGVAFLVHPKNRRKRREAQEAQEG
Uniprot No.

Target Background

Function
Recombinant Koribacter versatilis Sec-independent protein translocase protein TatC (tatC) is part of the twin-arginine translocation (Tat) system. This system transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes.
Database Links
Protein Families
TatC family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does Koribacter versatilis compare to other bacteria in terms of genome and protein expression?

Koribacter versatilis contains 5,650,368 nucleotides, 4,777 proteins, and 55 RNA genes, with a circular chromosome. It is a gram-negative, highly capsulated, aerobic heterotroph capable of growing with a range of sugars, sugar polymers, and some organic acids. While it has a slow growth rate (up to a week for visible colonies), it can comprise up to 14% of soil bacterial communities. Its closest phylogenetic relative is "Candidatus Solibacter usitatus" . This extensive genome likely includes genes encoding for the Tat machinery similar to other bacteria, though with adaptations specific to K. versatilis' environmental niche.

Is TatC likely to be an essential protein in Koribacter versatilis?

Based on research in H. pylori, where TatC has been shown to be essential for viability, it is reasonable to hypothesize that TatC may also be essential in K. versatilis. In H. pylori, attempts to create TatC deletion mutants were unsuccessful unless a plasmid-borne, inducible copy of tatC was introduced prior to transformation, suggesting TatC's critical role . Given the conservation of the Tat system across bacterial species and the importance of protein translocation for cellular function, TatC likely plays a similarly vital role in K. versatilis, particularly considering its complex ecological niche and metabolic versatility .

What are the recommended expression systems for recombinant K. versatilis TatC protein?

When expressing recombinant K. versatilis TatC, researchers should consider:

  • E. coli Expression Systems: BL21(DE3) or C41/C43(DE3) strains are often preferred for membrane proteins.

  • Expression Vectors: Using vectors with inducible promoters like pET or pBAD series.

  • Induction Conditions: Optimizing IPTG concentration and temperature is crucial. Lower temperatures (16-25°C) often yield better results for membrane proteins.

From H. pylori studies, researchers successfully used IPTG-inducible promoters (Ptac) to express TatC, suggesting similar approaches may work for K. versatilis TatC . Consider that K. versatilis grows slowly in nature (taking up to a week for visible colonies), so expression kinetics may differ from faster-growing bacteria .

What purification strategies are most effective for K. versatilis TatC?

For purification of recombinant K. versatilis TatC, consider:

  • Detergent Screening: Test multiple detergents (DDM, LDAO, etc.) for membrane protein extraction.

  • Affinity Chromatography: His-tag purification with IMAC is standard, but optimization of imidazole concentrations is necessary.

  • Size Exclusion Chromatography: Critical for removing aggregates and ensuring protein homogeneity.

  • Buffer Optimization: Include stabilizers like glycerol or specific lipids.

In H. pylori studies, researchers created conditional TatC mutants using plasmid pILL2150 with the tatC gene under control of an IPTG-inducible Ptac promoter, which could inform purification strategy development for K. versatilis TatC .

How can researchers verify the proper folding and activity of purified recombinant TatC?

Verification methods should include:

  • Circular Dichroism (CD): To assess secondary structure content.

  • Substrate Binding Assays: Using synthetic peptides containing twin-arginine motifs.

  • Reconstitution Studies: Testing functionality in proteoliposomes or nanodiscs.

  • Activity Complementation: Using conditional TatC mutants like those developed for H. pylori to verify function.

Research on H. pylori showed that TatC functionality could be assessed through hydrogenase and catalase activities, as these enzymes are Tat-dependent . Similar functional assays could be developed for K. versatilis TatC based on predicted Tat-dependent proteins in this organism.

Which proteins are likely to be translocated by the Tat system in K. versatilis?

While specific Tat-dependent proteins in K. versatilis haven't been extensively characterized, we can make predictions based on:

  • Signal Sequence Analysis: Identifying proteins with twin-arginine motifs (S/T-R-R-x-F-L-K) in their signal peptides.

  • Functional Homology: Looking for homologs of known Tat substrates in other bacteria.

In H. pylori, only four proteins were identified as Tat-dependent: hydrogenase (HydA), catalase-associated protein (KapA), biotin sulfoxide reductase (BisC), and the ubiquinol cytochrome oxidoreductase Rieske protein (FbcF) . Given K. versatilis' role in carbon cycling and iron dependency, iron-sulfur proteins and carbon metabolism enzymes are likely candidates for Tat-dependent translocation .

How can researchers design functional assays for K. versatilis TatC activity?

Functional assays could include:

Table 1: Recommended Functional Assays for K. versatilis TatC

Assay TypeMethodologyExpected OutcomeAdvantages
In vitro translocationReconstitute TatC in liposomes with fluorescently labeled substratesSubstrate translocation across membraneDirect measure of activity
ComplementationExpress K. versatilis TatC in conditional tatC mutants (e.g., H. pylori)Restoration of growth and Tat-dependent enzyme activitiesTests functionality in vivo
Co-immunoprecipitationPull-down experiments with tagged TatCIdentification of interacting partnersReveals protein-protein interactions
Substrate bindingSurface plasmon resonance with twin-arginine peptidesQuantification of binding kineticsMeasures specific recognition step

Studies in H. pylori demonstrated that tatC mutants had lower hydrogenase and catalase activities compared to wild-type strains, providing functional readouts for Tat system activity . Similar enzyme activity assays could be adapted for K. versatilis based on its predicted Tat substrates.

What cellular processes might be affected by TatC dysfunction in K. versatilis?

Based on H. pylori studies and K. versatilis ecology, TatC dysfunction likely affects:

  • Cell Envelope Integrity: H. pylori tat mutants displayed cell envelope defects , suggesting K. versatilis may show similar phenotypes.

  • Carbon Cycling: K. versatilis plays important roles in carbon monoxide oxidation and polymer degradation , processes potentially dependent on Tat-translocated enzymes.

  • Iron Metabolism: Given the importance of iron for K. versatilis survival , iron-related processes might be Tat-dependent.

  • Stress Response: Catalase and other stress-response proteins often require Tat-dependent translocation, as seen in H. pylori .

Research in H. pylori revealed that TatC is essential for viability, and conditional tatC mutants could grow only with IPTG induction of a plasmid-borne tatC copy , suggesting TatC disruption in K. versatilis might be similarly detrimental.

How can structural studies of K. versatilis TatC inform mechanism understanding?

Advanced structural approaches include:

  • Cryo-EM Analysis: Particularly suited for membrane protein complexes like the Tat system.

  • X-ray Crystallography: Challenging but potentially high-resolution if suitable crystals can be obtained.

  • NMR Studies: For dynamics and specific domain interactions.

  • Computational Modeling: Using homology modeling based on available TatC structures.

While no specific structural data on K. versatilis TatC exists in the provided sources, researchers can leverage structural information from other bacterial TatC proteins. Structural studies could reveal how K. versatilis TatC recognizes twin-arginine signal peptides and interacts with other Tat components, potentially explaining any unique properties related to K. versatilis' soil habitat .

What approaches can be used to study TatC-substrate interactions in K. versatilis?

For investigating TatC-substrate interactions:

  • Site-Directed Mutagenesis: Targeting conserved residues predicted to be involved in substrate binding.

  • Photo-Crosslinking: Using unnatural amino acids incorporated into TatC or substrates.

  • HDX-MS (Hydrogen-Deuterium Exchange Mass Spectrometry): To identify regions involved in protein-protein interactions.

  • In silico Docking: Computational prediction of interaction interfaces.

Research in H. pylori linked TatC essentiality to the FbcF protein (ubiquinol cytochrome oxidoreductase Rieske subunit) . Similar critical substrates could be identified in K. versatilis through targeted approaches, potentially revealing unique adaptations in this soil bacterium.

How does Koribacter versatilis TatC compare evolutionarily with TatC proteins from other bacterial species?

Evolutionary comparisons could focus on:

Table 2: Evolutionary Comparison Parameters for TatC Analysis

ParameterMethodologyExpected InsightsRelevance to K. versatilis
Sequence conservationMultiple sequence alignmentIdentification of highly conserved residuesMay reveal adaptations specific to soil bacteria
Phylogenetic analysisMaximum likelihood or Bayesian approachesEvolutionary relationships between TatC proteinsPosition of K. versatilis TatC in bacterial evolution
Selective pressure analysisdN/dS calculationsDetection of sites under positive selectionPotential adaptations to soil environment
Domain architectureComputational protein domain predictionFunctional domain conservation or innovationMay correlate with K. versatilis' unique ecological niche

K. versatilis belongs to the Acidobacteriota phylum, which is only distantly related to other bacterial domains . This evolutionary distance might be reflected in its TatC sequence and function, potentially revealing unique adaptations to its slow-growing lifestyle in iron-rich soil environments.

What are common challenges in expressing recombinant K. versatilis TatC and how can they be addressed?

Common challenges and solutions include:

  • Toxicity: Use tightly controlled inducible promoters (similar to the IPTG-inducible system used for H. pylori TatC ).

  • Inclusion Body Formation: Lower induction temperature, co-express with chaperones, or use fusion tags.

  • Low Yield: Optimize codon usage for expression host, considering K. versatilis' unique genome characteristics .

  • Protein Degradation: Include protease inhibitors throughout purification.

  • Aggregation: Screen detergents systematically; consider native nanodiscs.

Researchers working with H. pylori TatC found that only conditional tatC mutants could be generated , suggesting similar challenges might arise with K. versatilis TatC expression and pointing to the need for carefully controlled expression systems.

How can researchers distinguish between direct and indirect effects of TatC manipulation in functional studies?

To distinguish direct from indirect effects:

  • Complementation Studies: Reintroduce wild-type or mutant TatC and assess phenotype restoration.

  • Substrate-Specific Assays: Measure activities of individual Tat-dependent enzymes.

  • Temporal Analysis: Monitor effects immediately after TatC depletion versus long-term effects.

  • Control Experiments: Include Sec-dependent protein analysis as controls.

In H. pylori, complementation of tatC mutants restored hydrogenase and catalase activities to wild-type levels, confirming direct effects . Similar approaches could validate direct effects of TatC manipulation in K. versatilis studies.

What specialized techniques are required for analyzing membrane proteins like TatC in K. versatilis?

Specialized techniques include:

  • Membrane Fractionation: Optimized protocols for slow-growing bacteria like K. versatilis .

  • Blue Native PAGE: For analyzing intact membrane protein complexes.

  • Lipid Composition Analysis: To understand native membrane environment requirements.

  • Single-Particle Tracking: For dynamics studies in reconstituted systems.

  • Atomic Force Microscopy: For topological studies of membrane-embedded TatC.

Research on H. pylori showed that tat mutants had cell envelope defects , suggesting membrane analysis techniques will be particularly important for understanding K. versatilis TatC function in maintaining cellular integrity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.