Recombinant Koribacter versatilis Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Introduction to Undecaprenyl-diphosphatase

Undecaprenyl-diphosphatase (uppP) is an essential enzyme in bacterial cell wall biosynthesis that belongs to the hydrolase family with the Enzyme Commission number 3.6.1.27 . This enzyme is also known by alternative names including "Bacitracin resistance protein" and "Undecaprenyl pyrophosphate phosphatase," reflecting its dual role in basic metabolism and antimicrobial resistance mechanisms . The primary function of uppP is to catalyze the hydrolysis of undecaprenyl pyrophosphate to form undecaprenyl phosphate (C55P) and release inorganic phosphate in the process .

Undecaprenyl phosphate (C55P) serves as the universal carrier lipid for the biosynthesis of various bacterial cell wall polymers, making it essential for bacterial survival and growth . This lipid carrier facilitates the transport of cell wall precursors from the cytoplasm, where they are synthesized, to the external side of the cytoplasmic membrane, where polymerization occurs to form the cell wall structure . The recycling of this carrier through the dephosphorylation activity of enzymes like uppP is crucial for maintaining a sufficient pool of lipid carriers to support ongoing cell wall synthesis.

The significance of uppP in bacterial physiology extends beyond basic metabolism. As indicated by its alternative name "Bacitracin resistance protein," this enzyme contributes to antibiotic resistance mechanisms by counteracting the action of bacitracin, an antibiotic that binds to undecaprenyl pyrophosphate and prevents its dephosphorylation . By efficiently catalyzing this dephosphorylation reaction, uppP helps bacteria overcome the inhibitory effects of bacitracin, highlighting its potential as a target for novel antibiotic development strategies.

Koribacter versatilis as a Source Organism

Koribacter versatilis, particularly strain Ellin345, is the source organism for the uppP enzyme discussed in this article . This bacterium belongs to the phylum Acidobacteria, which represents one of the most abundant bacterial groups in soil ecosystems . Despite their ecological significance, Acidobacteria remain relatively understudied compared to other bacterial phyla, making the characterization of proteins like uppP from these organisms particularly valuable for expanding our understanding of bacterial diversity and metabolism.

Koribacter versatilis was originally isolated from soil samples and has been the subject of genomic analysis to better understand its metabolic capabilities and ecological roles . The whole genome of K. versatilis strain Ellin345 has been sequenced and analyzed, providing insights into its metabolic potential and the genetic basis of various enzymatic activities, including the uppP enzyme . This genomic information has facilitated the identification and recombinant expression of the uppP gene for detailed biochemical characterization.

Interestingly, K. versatilis has been noted for its capacity to produce hopanoids, which are pentacyclic triterpenoid lipids that serve as membrane rigidifiers in bacteria, similar to sterols in eukaryotes . The presence of genes involved in hopanoid biosynthesis, such as shc and those involved in methylation of hopanoids, has been detected in the genome of K. versatilis . While this aspect of K. versatilis metabolism is not directly related to uppP function, it highlights the metabolic versatility of this organism and its potential as a source of diverse enzymes and bioactive compounds for biotechnological applications.

Biochemical Properties and Activity

The undecaprenyl-diphosphatase activity of uppP involves the hydrolysis of undecaprenyl pyrophosphate to produce undecaprenyl phosphate (C55P) and inorganic phosphate . This reaction is critical for recycling the lipid carrier used in bacterial cell wall synthesis. The enzyme's catalytic mechanism likely involves nucleophilic attack on the phosphoester bond, facilitated by coordinated metal ions and conserved catalytic residues.

Studies on related undecaprenyl phosphate phosphatases have revealed important insights into their biochemical properties. For instance, some bacteria possess bifunctional enzymes that exhibit both kinase and phosphatase activities, catalyzing the reciprocal conversion between undecaprenyl phosphate (C55P) and undecaprenol (C55OH) . This bidirectional activity allows efficient regulation of the lipid carrier pool available for cell wall synthesis, particularly in Gram-positive bacteria .

The optimal conditions for uppP activity typically include a neutral to slightly alkaline pH range and moderate temperatures, consistent with the physiological conditions of bacterial cells. Metal ions, particularly magnesium, often play crucial roles in the catalytic activity of phosphatases by coordinating the phosphate group and facilitating nucleophilic attack .

Production and Purification of Recombinant uppP

The production of recombinant Koribacter versatilis uppP has been achieved using in vitro Escherichia coli expression systems . This approach involves cloning the uppP gene from K. versatilis strain Ellin345 into suitable expression vectors and transforming E. coli cells for protein production. The recombinant protein is typically expressed with affinity tags to facilitate purification, such as the N-terminal 10xHis-tag mentioned in the product information .

Two commercial forms of the recombinant protein have been identified:

Product CharacteristicFull-length ProductPartial Product
Product CodeCSB-CF626290KAAACSB-EP626290KAAA1-B
Protein LengthFull length (286 aa)Partial
Tag InformationN-terminal 10xHis-taggedVariable (determined during manufacturing)
PurityNot specified>85% (SDS-PAGE)
Storage Recommendation-20°C, for extended storage -20°C or -80°C-20°C/-80°C
Shelf Life (Liquid)6 months at -20°C/-80°C6 months at -20°C/-80°C
Shelf Life (Lyophilized)12 months at -20°C/-80°C12 months at -20°C/-80°C

The purification of recombinant membrane proteins like uppP presents significant challenges due to their hydrophobic nature and tendency to aggregate or denature when removed from the membrane environment. Typical purification strategies involve solubilization with detergents followed by affinity chromatography using the attached affinity tag, such as the His-tag .

For the partial recombinant product, reconstitution recommendations include dissolving the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol (final concentration) for long-term storage at -20°C/-80°C . Working aliquots can be stored at 4°C for up to one week, but repeated freezing and thawing is not recommended due to potential protein denaturation and activity loss .

Functional Significance in Bacterial Physiology

Undecaprenyl-diphosphatase plays a crucial role in bacterial cell wall synthesis by recycling the essential lipid carrier undecaprenyl phosphate (C55P) . The importance of this function is underscored by the universal presence of C55P-dependent pathways for the biosynthesis of various cell wall polymers across bacterial species, including peptidoglycans, lipopolysaccharides, teichoic acids, and capsular polysaccharides .

The recycling process involving uppP is particularly critical because the de novo synthesis of undecaprenyl phosphate is energetically costly for bacteria. The pathway begins with undecaprenyl pyrophosphate synthesis by undecaprenyl pyrophosphate synthase (UppS), an essential cis-prenyltransferase . Subsequently, the pyrophosphate form must be converted to the monophosphate form by phosphatases like uppP to participate in cell wall synthesis .

In addition to its metabolic role, uppP contributes to antibiotic resistance by counteracting the mechanism of action of bacitracin, which binds to undecaprenyl pyrophosphate and prevents its dephosphorylation . This inhibition disrupts the recycling of the lipid carrier, ultimately inhibiting cell wall synthesis and leading to bacterial cell death. By efficiently catalyzing the dephosphorylation reaction, uppP helps bacteria overcome this inhibitory effect, contributing to bacitracin resistance.

The importance of undecaprenyl phosphate metabolism in bacterial survival has made the enzymes involved, including uppP, attractive targets for antibiotic development . Inhibitors targeting these enzymes could potentially disrupt cell wall synthesis through a novel mechanism, potentially overcoming existing resistance mechanisms to current antibiotics that target different steps in cell wall synthesis.

Applications in Biotechnology and Drug Discovery

The recombinant K. versatilis undecaprenyl-diphosphatase has several potential applications in biotechnology and pharmaceutical research. As a key enzyme in bacterial cell wall synthesis, uppP represents a valuable tool for studying this essential process and developing novel antimicrobial strategies.

In drug discovery, uppP and related enzymes are promising targets for developing new antibiotics to address the growing challenge of antimicrobial resistance . The critical role of this enzyme in bacterial survival and its absence in mammalian cells make it an attractive target for selective inhibition. Previous research has identified compounds that inhibit related enzymes, such as undecaprenyl pyrophosphate synthase (UppS), demonstrating the potential of this approach . For instance, a compound designated MAC-0547630 has shown promise as a novel inhibitor of UppS and demonstrated the ability to potentiate β-lactam antibiotics .

For biotechnology applications, recombinant uppP can serve as a tool for enzymatic synthesis or modification of prenyl phosphates, which have applications in the production of various natural products and pharmaceuticals. The availability of well-characterized recombinant forms of the enzyme facilitates its use in these applications, offering advantages such as controlled production, consistent quality, and the potential for enzyme engineering to enhance specific properties.

Research applications of recombinant uppP include structural studies to better understand its catalytic mechanism, screening assays to identify novel inhibitors, and comparative studies with related enzymes from different bacterial species to understand evolutionary relationships and species-specific adaptations in cell wall synthesis pathways.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, serving as a reference point for your use.
Shelf Life
The shelf life is influenced by factors including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
uppP; Acid345_2082; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-286
Protein Length
full length protein
Species
Koribacter versatilis (strain Ellin345)
Target Names
uppP
Target Protein Sequence
MNAYLLAALLGVVEGLTEFLPVSSTAHLRICEALLHIDLGDGFWKMFSIVIQLGAILCLP IYFRARISEFFATFPKGKSGNHTALTHPLTLTIIAFLCTAIPAFLFTKIIGKHLESVIIM GSALLIGGIVMWIVDVMFADKGATDDMDKMSVGQAIWIGLCQVLSAVFPGTSRSMSTIAA GQLSGMTRAAALEFSFFLSIPTMVVATCYDLLKTLRHKDEAGAALGVVHMDAHAWITLAI GFIVSFIVAYFVVAWFMKWVRTRGFVPFAVYRIVVGIAVLAWALKR
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of Undecaprenyl-diphosphatase (UppP) in bacterial cell wall synthesis?

Undecaprenyl-diphosphatase (UppP) catalyzes the critical dephosphorylation of undecaprenyl pyrophosphate (UPP) to undecaprenyl phosphate (UP), an essential carrier lipid in bacterial cell wall synthesis. This 55-carbon isoprenoid carrier functions as a universal transporter that ferries glycans and glycopolymers across the cytoplasmic membrane, including peptidoglycan precursors, O-antigen, capsule components, wall teichoic acids, and various sugar modifications . The dephosphorylation reaction catalyzed by UppP is indispensable for recycling the carrier lipid, ensuring its availability for continuous rounds of cell wall synthesis. In bacteria such as Bacillus subtilis, this reaction represents a bottleneck in the lipid II cycle, directly affecting cell wall homeostasis and integrity .

How does Koribacter versatilis UppP compare structurally to other bacterial UPP phosphatases?

While the specific structure of Koribacter versatilis UppP has not been extensively characterized in the provided research, comparative analysis with homologous proteins suggests it likely shares key structural features with other bacterial UPP phosphatases. K. versatilis, a member of the Acidobacteriota phylum, possesses a circular chromosome with 5,650,368 nucleotides encoding 4,777 proteins . Based on studies of UPP phosphatases in other bacteria, particularly Bacillus subtilis, K. versatilis UppP likely belongs to a distinct phosphatase family separate from the PAP2 phosphatases (such as BcrC in B. subtilis). The protein presumably contains transmembrane domains and conserved catalytic residues necessary for its phosphatase activity. Structural prediction using homology modeling would be required to definitively identify unique features that may distinguish K. versatilis UppP from its counterparts in other bacterial species.

What are the typical expression patterns of uppP genes in Koribacter versatilis?

Though specific expression data for uppP in Koribacter versatilis is limited in the available research, insights can be drawn from related bacteria. In Bacillus subtilis, the uppP gene (also known as yubB) shows expression levels comparable to bcrC during exponential growth, with approximately three-fold higher expression during stationary phase . Unlike bcrC, uppP expression in B. subtilis is not significantly induced by cell envelope stress conditions such as exposure to bacitracin . Considering K. versatilis's environmental niche as a soil bacterium with relatively slow growth rates (sometimes taking up to a week to form visible colonies), it's reasonable to hypothesize that uppP expression might be constitutive but regulated in response to growth phases and environmental conditions . Research using transcriptomic approaches would be necessary to precisely characterize uppP expression patterns in K. versatilis under various growth conditions.

What are the optimal conditions for heterologous expression of recombinant K. versatilis UppP?

For heterologous expression of recombinant Koribacter versatilis UppP, researchers should consider the following protocol based on the unique properties of both the organism and the enzyme:

Expression System Selection:

  • E. coli BL21(DE3) or C43(DE3) strains are recommended for membrane protein expression

  • Consider codon optimization for K. versatilis genes, as this slow-growing soil bacterium may have codon usage patterns divergent from common expression hosts

Vector Design:

  • Use pET vectors with N-terminal His6-tag or C-terminal Strep-tag

  • Include a TEV protease cleavage site for tag removal

  • Consider fusion partners (e.g., MBP) to enhance solubility

Expression Conditions:

  • Growth temperature: 18-20°C after induction to minimize inclusion body formation

  • Inducer concentration: 0.1-0.5 mM IPTG

  • Post-induction time: 16-20 hours

  • Medium: Terrific Broth supplemented with 1% glucose

Membrane Protein Considerations:

  • Supplement with 10 mM MgCl₂ to stabilize membrane fractions

  • Consider autoinduction media to achieve higher cell densities before protein expression

These conditions should be systematically optimized through small-scale expression trials analyzing variables including temperature, inducer concentration, and expression time to maximize functional protein yield.

What purification strategy yields the highest activity for recombinant K. versatilis UppP?

A comprehensive purification strategy for recombinant K. versatilis UppP should address the challenges associated with membrane protein purification while preserving enzymatic activity:

Membrane Isolation:

  • Harvest cells and resuspend in buffer containing 50 mM Tris-HCl pH 7.5, 300 mM NaCl, 10% glycerol, 1 mM DTT, and protease inhibitors

  • Disrupt cells via sonication or French press (20,000 psi, 3 passes)

  • Remove debris by centrifugation (10,000 × g, 20 min, 4°C)

  • Ultracentrifuge supernatant (150,000 × g, 1 h, 4°C) to isolate membrane fraction

Solubilization:

  • Resuspend membrane pellet in solubilization buffer containing 50 mM Tris-HCl pH 7.5, 300 mM NaCl, 10% glycerol, and detergent

  • Optimal detergents include:

    • n-Dodecyl-β-D-maltopyranoside (DDM): 1%

    • n-Decyl-β-D-maltopyranoside (DM): 1%

    • Lauryl maltose neopentyl glycol (LMNG): 0.5%

  • Incubate with gentle rotation for 2 hours at 4°C

  • Ultracentrifuge (150,000 × g, a1 h, 4°C) to remove insoluble material

Affinity Chromatography:

  • Load solubilized protein onto Ni-NTA or Strep-Tactin column

  • Wash with 10-15 column volumes of wash buffer containing 50 mM Tris-HCl pH 7.5, 300 mM NaCl, 0.05% detergent, and 20 mM imidazole (for His-tag)

  • Elute with buffer containing 250 mM imidazole (for His-tag) or 2.5 mM desthiobiotin (for Strep-tag)

Size Exclusion Chromatography:

  • Apply concentrated protein to Superdex 200 column

  • Elute with buffer containing 25 mM Tris-HCl pH 7.5, 150 mM NaCl, and 0.03% detergent

Throughout purification, maintain 5-10 mM MgCl₂ in all buffers as divalent cations are often essential for phosphatase activity. This strategy typically yields 1-3 mg of purified protein per liter of bacterial culture with preserved enzymatic activity.

What methods are reliable for measuring UppP activity in vitro?

Several complementary methods can be employed to reliably measure UppP activity in vitro:

Malachite Green Phosphate Assay:

  • Principle: Detects released inorganic phosphate from UPP dephosphorylation

  • Procedure:

    • Prepare reaction mixture containing 50 mM Tris-HCl pH 7.5, 10 mM MgCl₂, 0.1% Triton X-100, and 50-100 μM UPP substrate

    • Add purified UppP (1-5 μg) to initiate reaction

    • Incubate at 37°C for 5-30 minutes

    • Stop reaction with malachite green reagent

    • Measure absorbance at 630 nm

  • Advantages: High sensitivity (nanomolar range), amenable to high-throughput screening

  • Limitations: Potential interference from buffer components containing phosphate

Thin Layer Chromatography (TLC):

  • Principle: Separates substrate (UPP) from product (UP) based on differential migration

  • Procedure:

    • Perform enzyme reaction with radiolabeled [³²P]-UPP

    • Extract lipids using chloroform:methanol (2:1)

    • Spot on silica TLC plates

    • Develop using chloroform:methanol:water:ammonium hydroxide (65:25:4:0.5)

    • Visualize by autoradiography

  • Advantages: Direct visualization of substrate-product conversion

  • Limitations: Requires radioactive materials, lower throughput

Coupled Enzyme Assay:

  • Principle: Couples phosphate release to NADH oxidation via enzymatic reactions

  • Procedure:

    • Reaction mixture contains UppP, UPP, purine nucleoside phosphorylase, and 2-amino-6-mercapto-7-methylpurine ribonucleoside

    • Released phosphate triggers conversion of MESG to ribose-1-phosphate and 2-amino-6-mercapto-7-methylpurine

    • Monitor absorbance decrease at 360 nm

  • Advantages: Continuous monitoring, high sensitivity

  • Limitations: Potential interference from coupling enzymes

LC-MS/MS Analysis:

  • Principle: Direct quantification of UPP and UP by mass spectrometry

  • Procedure:

    • Extract lipids after enzyme reaction

    • Analyze by reverse-phase HPLC coupled to mass spectrometry

    • Quantify substrate depletion and product formation

  • Advantages: Highly specific, can detect multiple reaction intermediates

  • Limitations: Requires specialized equipment, lower throughput

A combination of these methods is recommended for comprehensive characterization of K. versatilis UppP activity.

How does the function of K. versatilis UppP differ from UppP homologs in other bacterial species?

The function of K. versatilis UppP likely exhibits distinctive characteristics compared to homologs in other bacterial species, reflecting adaptation to its unique ecological niche. While direct experimental evidence is limited, comparative analysis suggests several potential functional differences:

Substrate Specificity and Kinetics:
K. versatilis inhabits acidic soil environments where pH and mineral composition differ significantly from the habitats of model organisms like E. coli or B. subtilis. Its UppP may demonstrate:

  • Optimized activity at acidic pH ranges (pH 4.5-6.0)

  • Different metal ion preferences for catalysis (potentially Fe³⁺-dependent given K. versatilis's requirement for iron)

  • Modified kinetic parameters (Km, kcat) reflecting adaptation to slower growth rates

Regulatory Mechanisms:
Unlike B. subtilis, where uppP expression remains relatively stable during cell envelope stress , K. versatilis UppP may be regulated differently:

  • Potential integration with stress response systems specific to acidobacteria

  • Different transcriptional control mechanisms reflecting its environmental exposures

  • Possible post-translational modifications unique to K. versatilis

Physiological Role:
In B. subtilis, UppP works alongside BcrC with partial functional redundancy, with UppP being particularly crucial for sporulation . K. versatilis has not been documented to form spores, suggesting its UppP might have evolved:

  • Greater importance in vegetative growth

  • Specialized functions in cell wall modifications required for survival in acidic soils

  • Possible involvement in cell wall adaptations related to K. versatilis's role in carbon cycling

Structural Distinctions:
Computational modeling based on sequence homology predicts potential structural differences in K. versatilis UppP:

  • Modified transmembrane topology adapted to the unique membrane composition of Acidobacteriota

  • Different substrate binding pocket architecture

  • Potentially unique regulatory domains or protein-protein interaction surfaces

Experimental approaches combining heterologous expression, mutagenesis, and comparative biochemistry would be necessary to fully elucidate these functional differences.

What is the role of K. versatilis UppP in antibiotic resistance mechanisms?

While direct evidence for K. versatilis UppP's role in antibiotic resistance is not explicitly detailed in the provided research, several hypotheses can be proposed based on knowledge of UPP phosphatases in other bacteria:

Potential Direct Resistance Mechanisms:

  • Bacitracin Resistance: UPP phosphatases are known to contribute to bacitracin resistance by reducing the pool of UPP (bacitracin's target) through accelerated conversion to UP. In B. subtilis, increased expression of bcrC (but not uppP) provides protection against bacitracin . K. versatilis UppP might similarly contribute to intrinsic bacitracin resistance, particularly significant given its soil habitat where Bacillus species producing bacitracin are common.

  • Glycopeptide Antibiotic Interactions: Recent antibiotic discovery efforts have focused on compounds that bind lipid-linked precursors to deplete the universal carrier lipid undecaprenyl-phosphate . K. versatilis UppP may provide resistance against such compounds by maintaining adequate UP levels despite antibiotic challenge.

  • Cell Wall Stress Response Integration: In B. subtilis, UPP phosphatases are integrated with the cell envelope stress response (CESR) system, with bcrC being induced by the σᴹ stress response . K. versatilis likely possesses analogous stress response systems that might upregulate UppP activity during antibiotic exposure.

Experimental Approaches to Investigate Resistance Functions:

  • Heterologous expression studies in model organisms lacking UPP phosphatases

  • Minimum inhibitory concentration (MIC) determinations with various antibiotics

  • Transcriptomic analysis of K. versatilis under antibiotic challenge

  • In vitro assays testing direct interactions between antibiotics and purified UppP

The slow growth rate of K. versatilis (up to a week for visible colonies) might contribute to intrinsic antibiotic resistance by reducing the impact of cell wall synthesis inhibitors that are most effective against rapidly dividing cells. The UppP enzyme may have evolved specific properties to maintain cell wall integrity under these slow growth conditions.

What are common challenges in expressing and purifying functional recombinant K. versatilis UppP?

Researchers working with recombinant K. versatilis UppP frequently encounter several challenges during expression and purification, which can be addressed through specific troubleshooting strategies:

Challenge 1: Low Expression Yields

  • Cause: Codon bias discrepancies between K. versatilis and expression hosts

  • Solution: Employ codon-optimized synthetic genes for the expression host (typically E. coli)

  • Implementation: Analyze the codon adaptation index (CAI) and optimize rare codons, particularly for the first 50-100 nucleotides of the coding sequence

Challenge 2: Protein Misfolding and Inclusion Body Formation

  • Cause: Membrane proteins often misfold when overexpressed

  • Solution: Modify expression conditions and consider fusion partners

  • Implementation:

    • Reduce induction temperature to 16-18°C

    • Decrease IPTG concentration to 0.1 mM

    • Add 5% glycerol to culture medium

    • Consider fusion with MBP or SUMO proteins

Challenge 3: Inactive Enzyme After Purification

  • Cause: Loss of essential lipid interactions or cofactors during purification

  • Solution: Optimize detergent selection and maintain cofactors

  • Implementation:

    • Screen multiple detergents (DDM, LMNG, DMNG)

    • Maintain 5-10 mM MgCl₂ throughout purification

    • Consider lipid supplementation (E. coli lipid extract at 0.01-0.05 mg/ml)

Challenge 4: Protein Aggregation During Concentration

  • Cause: Detergent concentration increase during protein concentration

  • Solution: Careful detergent management during concentration steps

  • Implementation:

    • Use concentration devices with higher molecular weight cut-offs (50-100 kDa)

    • Add fresh detergent at CMC during concentration

    • Consider alternative concentration methods like precipitation and resolubilization

Challenge 5: Inconsistent Activity Measurements

  • Cause: Variability in substrate preparation and enzyme stability

  • Solution: Standardize reagents and assay conditions

  • Implementation:

    • Prepare UPP substrate stocks in small aliquots with consistent sonication protocol

    • Include internal standards in activity assays

    • Perform activity measurements immediately after purification

A systematic approach to addressing these challenges significantly improves the likelihood of obtaining functionally active K. versatilis UppP for subsequent biochemical and structural studies.

How can researchers distinguish the activity of UppP from other phosphatases in cellular extracts?

Distinguishing UppP activity from other phosphatases in cellular extracts requires specialized approaches that exploit the unique properties of this enzyme:

Substrate Specificity-Based Methods:

  • Differential Inhibition Profile:

    • Treat extracts with phosphatase inhibitors with varying specificities:

      • Sodium orthovanadate (1 mM): inhibits tyrosine and alkaline phosphatases

      • Okadaic acid (100 nM): inhibits PP1 and PP2A serine/threonine phosphatases

      • Fluoride (50 mM): inhibits acid phosphatases

    • UppP activity is relatively resistant to these classical inhibitors

  • Detergent Dependency:

    • UppP requires detergent for optimal activity due to its membrane-associated nature

    • Assay phosphatase activity with and without 0.1% Triton X-100 or DDM

    • UppP activity increases significantly with detergent while many cytosolic phosphatases show reduced activity

  • Bacitracin Sensitivity:

    • UppP activity against UPP is inhibited by bacitracin (50-100 μg/ml)

    • Measure phosphatase activity with and without bacitracin

    • Bacitracin-sensitive component represents UPP phosphatase activity

Analytical Separation Techniques:

  • Fractionation Approach:

    FractionPreparation MethodExpected UppP Activity
    Cytosolic100,000×g supernatantMinimal
    Membrane100,000×g pellet, detergent-solubilizedHigh
    PeriplasmicOsmotic shock extractionMinimal
    Cell wallSDS-boiling of pellet after membrane extractionNone
  • Ion Exchange Chromatography:

    • Apply detergent-solubilized membrane fractions to anion exchange column

    • Elute with NaCl gradient (0-500 mM)

    • Collect fractions and assay for phosphatase activity using UPP

    • UppP typically elutes at distinct NaCl concentration from other phosphatases

Molecular Biology Approaches:

  • Immunodepletion:

    • Generate antibodies against recombinant K. versatilis UppP

    • Perform immunoprecipitation to deplete UppP from extracts

    • Compare phosphatase activity before and after immunodepletion

  • Genetic Complementation:

    • Express K. versatilis UppP in uppP-deficient bacteria

    • Measure restored UPP phosphatase activity

    • Confirms specificity of the enzyme for UPP substrate

These complementary approaches provide researchers with robust methods to distinguish UppP activity from other phosphatases, essential for accurate characterization of this enzyme.

What strategies can overcome the challenges of working with K. versatilis, given its slow growth rate?

Koribacter versatilis presents unique challenges for researchers due to its extremely slow growth rate, sometimes requiring up to a week to form visible colonies . Several innovative strategies can overcome these limitations:

Heterologous Expression Systems:

  • Advantage: Bypasses the need to culture K. versatilis directly

  • Implementation:

    • Clone the uppP gene from K. versatilis genomic DNA

    • Express in rapid-growing hosts (E. coli, B. subtilis)

    • Validate function through complementation of uppP-deficient strains

    • Optimize expression using codon-harmonized sequences

  • Limitation: May not capture native regulation and post-translational modifications

Culture Optimization for Native K. versatilis:

  • Advantage: Preserves natural context of UppP expression

  • Implementation:

    • Develop specialized media mimicking soil conditions:

      • pH 4.5-5.5

      • Supplemented with micronutrients, particularly iron compounds

      • Include humic substances (0.01-0.05%)

    • Employ microfluidic cultivation techniques for monitoring single cells

    • Use extended incubation periods (2-3 weeks) at 25-28°C

    • Consider co-culture with helper strains producing growth factors

  • Limitation: Still significantly slower than model organisms

Cell-Free Expression Systems:

  • Advantage: Rapid protein production without cell cultivation

  • Implementation:

    • Develop cell extracts from E. coli or wheat germ

    • Add specialized lipids and cofactors required for UppP activity

    • Express K. versatilis UppP using optimized templates

    • Directly assay function in the cell-free reaction

  • Limitation: May require optimization for membrane protein expression

Genomic and Bioinformatic Approaches:

  • Advantage: Minimal reliance on cultivating the organism

  • Implementation:

    • Analyze the K. versatilis genome sequence for uppP homologs

    • Perform comparative genomics with related bacterial species

    • Identify conserved regions and predict functional domains

    • Model protein structure using homology-based approaches

  • Limitation: Requires experimental validation of predictions

Metatranscriptomic Studies:

  • Advantage: Captures gene expression in natural environments

  • Implementation:

    • Extract total RNA from soil samples known to contain K. versatilis

    • Enrich for K. versatilis transcripts using specific probes

    • Sequence and analyze uppP expression under various environmental conditions

    • Correlate expression with environmental parameters

  • Limitation: Complex sample preparation and data analysis

By combining these approaches, researchers can overcome the growth limitations of K. versatilis while still gaining valuable insights into the function and properties of its UppP enzyme.

What are promising approaches for structural determination of K. versatilis UppP?

Structural determination of Koribacter versatilis UppP presents both challenges and opportunities. The following approaches offer promising pathways toward elucidating its three-dimensional structure:

X-ray Crystallography:

  • Strategy: Lipidic cubic phase (LCP) crystallization

  • Implementation:

    • Purify K. versatilis UppP with stability-enhancing mutations (e.g., thermostabilization through disulfide engineering)

    • Reconstitute in monoolein or related lipids at 40-60% (w/w)

    • Screen crystallization conditions focusing on pH 4.5-6.5 (matching K. versatilis natural environment)

    • Utilize microcrystallization techniques with specialized screening suites for membrane proteins

    • Collect diffraction data at synchrotron microfocus beamlines

  • Expected Resolution: 2.0-3.5 Å

  • Advantages: High-resolution details of active site architecture

  • Challenges: Difficulty obtaining well-diffracting crystals of membrane proteins

Cryo-Electron Microscopy (Cryo-EM):

  • Strategy: Single-particle analysis of detergent-solubilized or nanodisc-embedded UppP

  • Implementation:

    • Purify K. versatilis UppP at high concentration (>5 mg/ml)

    • Consider reconstruction approaches:

      • Standard single-particle analysis (may be challenging due to small size)

      • Reconstitution into nanodiscs to increase effective molecular size

      • Attachment to Fab fragments to provide additional mass for alignment

    • Utilize latest-generation electron microscopes with energy filters

    • Employ motion correction and CTF estimation software

  • Expected Resolution: 3.0-4.5 Å

  • Advantages: No crystallization required; potential visualization of different conformational states

  • Challenges: Small size of UppP (~30 kDa) makes particle alignment difficult

NMR Spectroscopy:

  • Strategy: Solution NMR with selective isotopic labeling

  • Implementation:

    • Express K. versatilis UppP with ¹⁵N, ¹³C, and selective ²H labeling

    • Purify in detergent micelles optimized for NMR (e.g., DPC, LPPG)

    • Perform TROSY-based experiments for backbone assignment

    • Utilize paramagnetic relaxation enhancement (PRE) to define topology

    • Collect residual dipolar coupling (RDC) data for refinement

  • Expected Resolution: Atomic-level information for key regions

  • Advantages: Dynamic information; potential for studying substrate interactions

  • Challenges: Signal overlap; size limitations for complete structure determination

Integrative Structural Biology Approaches:

Each of these approaches offers unique advantages, and a combination of methods would likely yield the most comprehensive structural understanding of K. versatilis UppP.

How might the study of K. versatilis UppP contribute to antibiotic development?

The study of Koribacter versatilis UppP offers several promising avenues for antibiotic development that could address the growing challenge of antimicrobial resistance:

Novel Target Identification:
Koribacter versatilis represents an understudied bacterial phylum (Acidobacteriota) that constitutes up to 14% of soil bacterial communities . Structural and functional characterization of its UppP could reveal unique features that differentiate it from homologs in pathogenic bacteria, potentially leading to:

  • Identification of druggable pockets specific to pathogen UppP enzymes

  • Discovery of natural inhibitor compounds produced by K. versatilis as competitive advantage

  • Understanding of resistance mechanisms that could be circumvented in drug design

Lipid II Cycle Vulnerability Mapping:
Research has shown that UPP phosphatases like BcrC and UppP form a synthetic lethal gene pair in B. subtilis . Similar studies with K. versatilis UppP could:

  • Identify critical residues that could be targeted by combination therapeutics

  • Map the vulnerability landscape of the lipid II cycle

  • Reveal potential synergies between UppP inhibitors and existing antibiotics

Structural Scaffold for Rational Drug Design:
Structural determination of K. versatilis UppP would provide valuable templates for:

  • Structure-based virtual screening against pathogen homologs

  • Fragment-based drug discovery targeting the active site

  • Design of transition-state analogs specific to the UPP dephosphorylation reaction

Resistance Mechanism Insights:
Recent research indicates that UPP phosphatases contribute to bacterial resilience against antibiotics targeting cell wall synthesis . Studying K. versatilis UppP could:

  • Elucidate novel resistance mechanisms

  • Identify ways to overcome existing resistance

  • Develop inhibitors that block both enzyme activity and resistance development

Potential Drug Development Pathway:

Development StageResearch FocusExpected Outcomes
Target ValidationCompare essentiality of UppP across bacterial speciesConfirmation of broad-spectrum potential
Lead IdentificationHigh-throughput screening against K. versatilis UppPDiscovery of inhibitor scaffolds
Structure-Activity RelationshipSynthesize analogs of hit compoundsOptimization of potency and selectivity
Mechanism StudiesAnalyze binding mode and inhibition kineticsRational design of improved compounds
Resistance DevelopmentSerial passage with sub-MIC concentrationsPrediction and prevention of resistance
Combination StudiesTest synergy with existing antibioticsIdentification of potential combination therapies

The unique ecological niche of K. versatilis in acidic soils suggests it may produce or be resistant to natural products with antimicrobial activity, making it a promising source for novel antibiotic discovery. Additionally, understanding how this slow-growing bacterium maintains cell wall homeostasis could reveal new strategies for targeting metabolically quiescent bacterial populations that are often refractory to conventional antibiotics.

What research questions remain unanswered regarding the role of UppP in bacterial cell wall synthesis?

Despite advances in understanding UPP phosphatases, significant knowledge gaps remain regarding UppP's role in bacterial cell wall synthesis, particularly in non-model organisms like Koribacter versatilis:

Evolutionary and Comparative Biology Questions:

  • How do UppP enzymes from different bacterial phyla compare in terms of structure, substrate specificity, and regulation?

  • What evolutionary pressures have shaped UppP diversity across bacterial species, particularly in specialized environments like the acidic soils inhabited by K. versatilis?

  • How has UppP co-evolved with other enzymes in the cell wall synthesis pathway to optimize lipid carrier recycling in different bacterial lineages?

Regulatory Mechanisms:

  • How is uppP gene expression regulated in K. versatilis compared to model organisms like B. subtilis?

  • What environmental triggers modulate UppP activity in soil bacteria, and how does this compare to pathogens?

  • Is K. versatilis UppP regulated post-translationally through modifications or protein-protein interactions?

Structural and Mechanistic Inquiries:

  • What are the molecular determinants of UppP substrate specificity and catalytic efficiency?

  • How does the three-dimensional structure of K. versatilis UppP compare to known structures from other bacteria?

  • What conformational changes occur during substrate binding and catalysis?

Systems Biology Perspectives:

  • How does UppP activity influence global cell wall homeostasis and the distribution of undecaprenyl-phosphate between competing pathways?

  • What is the quantitative contribution of UppP to undecaprenyl-phosphate recycling compared to de novo synthesis?

  • How do bacteria balance UppP activity with other phosphatases in response to environmental stresses?

Experimental Approaches to Address These Questions:

Research QuestionExperimental ApproachExpected Outcome
Species-specific UppP characteristicsHeterologous expression and biochemical characterizationComparative kinetic parameters across bacterial phyla
Regulation of uppP expressionRNA-seq under various conditions; promoter-reporter fusionsIdentification of regulatory networks controlling uppP
UppP structure-function relationshipSite-directed mutagenesis coupled with activity assaysMapping of critical residues for catalysis and specificity
Role in cell wall homeostasisMetabolic labeling of lipid intermediates; lipidomicsQuantification of UppP contribution to UP pool
Integration with stress responsesTranscriptomics of UppP-depleted cellsIdentification of compensatory mechanisms

These research questions represent fertile ground for future investigations, with potential implications for understanding bacterial cell wall biosynthesis across diverse species and environments. The unique properties of K. versatilis, including its ecological niche, slow growth rate, and phylogenetic position, make its UppP an intriguing subject for comparative studies that could reveal novel aspects of bacterial cell wall synthesis regulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.