Recombinant Kosmotoga olearia Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Role of cobS in Cobalamin Biosynthesis

Cobalamin synthase (cobS) catalyzes the final steps in adenosylcobalamin synthesis, specifically linking adenosylcobinamide-GDP to α-ribazole-5′-phosphate to form adenosylcobalamin-5′-phosphate, which is subsequently dephosphorylated to adenosylcobalamin . This enzyme is critical for completing the nucleotide loop that binds the cobalt ion, enabling cofactor activity in enzymatic processes like methionine synthase and ribonucleotide reductase .

Recombinant cobS in Model Organisms

Recombinant cobS proteins have been characterized in several bacteria, including Salmonella typhimurium and Carboxydothermus hydrogenoformans.

OrganismSourceKey FunctionRecombinant ExpressionReferences
Salmonella typhimuriumPlasmid-based overexpressionSynthesizes adenosylcobalamin-5′-phosphate from adenosylcobinamide-GDP and α-ribazole-5′-phosphatePurified His-tagged protein
Carboxydothermus hydrogenoformansE. coli expression systemFull-length cobS (1–255 aa) with N-terminal His-tag; used for structural studiesFunctional in vitro assays
Thermotoga lettingaeNative genomic contextSalvages cobinamide to produce cobalamin via cobS-dependent pathwaysTranscriptional regulation

Hypothetical Role in Kosmotoga olearia

K. olearia, a thermophilic bacterium in the Thermotogales, exhibits a unique ability to thrive across a broad temperature range (20–79°C) . While its genome contains genes for cobalamin biosynthesis, direct evidence for cobS activity remains uncharacterized. Based on comparative genomics and studies in related Thermotogales (e.g., Thermotoga lettingae), cobS in K. olearia may:

  • Enable cobalamin salvage: Similar to Thermotoga lettingae, K. olearia could utilize cobS to synthesize cobalamin from extracellular cobinamide .

  • Support thermophilic metabolism: Cobalamin-dependent enzymes (e.g., ribonucleotide reductase) may require cobS-derived adenosylcobalamin for high-temperature growth .

Research Gaps and Future Directions

While cobS is well-studied in mesophilic and anaerobic bacteria, its role in thermophilic Thermotogales like K. olearia remains underexplored. Key questions include:

  • Temperature Adaptation: How does K. olearia’s cobS maintain activity at 65–77°C?

  • Salvage Pathway Efficiency: Does K. olearia prioritize de novo synthesis or cobinamide salvage?

  • Industrial Applications: Could recombinant K. olearia cobS enhance cobalamin production in bioreactors?

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. If you have specific requirements for the format, please indicate them during order placement. We will accommodate your requests as best as possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. This can be used as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize developing it.
Synonyms
cobS; Kole_0456; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Kosmotoga olearia (strain TBF 19.5.1)
Target Names
cobS
Target Protein Sequence
MWNDMKLAIAFLSRVPVPLKQNKGNLKKICAYFTFVGYLAGVFYFSMKLISENFLWTLLS VALGFYLFDLFHFDGLLDTLDGFFYQGTKERRFEIMSKGDIGPFAFFYAALYIVAYLYAF LHVDPIDLIYVAVLGRFSMNILLHFGKPAKNTGLGKLLHPYEKKHTLISLVFTIPLVYFP LNYIISLSIALLLGSSMHFITNRKIEGYTGDVLGATCMFSQLSIMVALSLI
Uniprot No.

Target Background

Function
Cobalamin synthase (CobS) from *Kosmotoga olearia* is an enzyme that catalyzes the biosynthesis of cobalamin (vitamin B12). It joins adenosylcobinamide-GDP and alpha-ribazole to generate adenosylcobalamin (Ado-cobalamin). Additionally, it synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links
Protein Families
CobS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the optimal expression conditions for recombinant K. olearia CobS?

Recombinant K. olearia CobS expression requires careful consideration of the unique physiological characteristics of the source organism. K. olearia is a thermophilic, anaerobic bacterium that grows optimally at 65°C, pH 6.8, and NaCl concentrations of 25-30 g/L . When expressing recombinant CobS, these parameters should inform your expression system design.

For heterologous expression in E. coli, consider the following methodological approach:

  • Use temperature-inducible promoters with initial growth at 37°C followed by induction at 42-45°C to mimic the thermophilic origin

  • Include appropriate osmolytes (25-30 g/L NaCl equivalent) in the media to maintain protein folding

  • Maintain anaerobic conditions during expression to preserve enzyme activity

  • Buffer the media to pH 6.8 to reflect the optimal pH for K. olearia growth

Expression in alternative hosts such as Thermotoga species may offer improved folding and activity due to their closer phylogenetic relationship to Kosmotoga, though with typically lower protein yields.

How does K. olearia CobS compare structurally to CobS from other organisms?

While specific structural data for K. olearia CobS is limited, comparative analysis with the well-characterized Salmonella typhimurium CobS provides valuable insights. S. typhimurium CobS functions as a cobalamin(-5′-phosphate) synthase, catalyzing the synthesis of adenosylcobalamin-5′-phosphate from adenosylcobinamide-GDP and α-ribazole-5′-phosphate .

Key structural and functional comparisons:

  • Both enzymes likely share the core catalytic domain necessary for connecting the nucleotide loop to the corrin ring

  • K. olearia CobS may possess adaptations for thermostability, including increased salt bridges, hydrophobic interactions, and reduced flexible loops

  • Thermotoga species, phylogenetically related to Kosmotoga, utilize the cobinamide salvage pathway rather than de novo synthesis , suggesting K. olearia likely employs similar metabolic strategies

Homology modeling using Thermotoga CobS sequences as templates provides the most reliable structural predictions until crystal structures become available.

What is the predicted substrate specificity of K. olearia CobS?

Based on data from related organisms, K. olearia CobS likely exhibits the following substrate specificity pattern:

Primary substrates:

  • Adenosylcobinamide-GDP (the product of the CobU reaction)

  • α-ribazole-5′-phosphate (the product of the CobT reaction)

Thermotoga species require exogenous cobinamide to produce vitamin B12 , suggesting K. olearia may similarly rely on the cobinamide salvage pathway rather than complete de novo synthesis. This implies that the CobS enzyme would be essential for completing B12 biosynthesis from salvaged precursors.

How should I design activity assays for recombinant K. olearia CobS?

Designing robust activity assays for K. olearia CobS requires accounting for its thermophilic origin and specific reaction chemistry. The following methodological approach is recommended:

Temperature optimization protocol:

  • Prepare reaction buffer (50 mM HEPES or phosphate buffer, pH 6.8)

  • Test enzyme activity across a temperature range (37-80°C) to determine optimal temperature

  • Include thermostability assessment by pre-incubating enzyme at test temperatures for varied durations before substrate addition

Standard enzymatic assay:

  • Combine purified recombinant CobS with adenosylcobinamide-GDP and α-ribazole-5′-phosphate

  • Incubate at optimal temperature (likely 60-70°C based on K. olearia growth optimum )

  • Monitor reaction progress by HPLC separation and UV-visible detection of adenosylcobalamin-5′-phosphate

  • Quantify using standard curves prepared with authentic standards

Alternative coupled assay:

  • Include CobC enzyme (cobalamin-5′-phosphate phosphatase) in the reaction mixture

  • Measure complete conversion to adenosylcobalamin

  • Quantify by microbiological assay using cobalamin-dependent indicator organisms like Lactobacillus delbrueckii

Critically, all assays should include appropriate controls to account for thermally-induced substrate degradation at higher temperatures.

What expression systems are most suitable for producing active K. olearia CobS?

The selection of an expression system for K. olearia CobS should balance protein yield with proper folding and activity of this thermophilic enzyme:

Recommended expression systems in order of preference:

  • Thermophilic expression hosts:

    • Thermus thermophilus (growth temperature: 65-70°C)

    • Thermotoga species (optimally T. maritima, growth temperature: 60-80°C)

    • Advantages: Natural chaperones for thermophilic proteins; post-translational processing aligned with source organism

  • E. coli-based systems with thermostability enhancements:

    • BL21(DE3) with co-expression of chaperones (GroEL/ES, DnaK)

    • Arctic Express™ strains containing cold-adapted chaperones

    • Addition of osmolytes (trehalose, glycine betaine) to stabilize protein folding

    • IPTG induction at elevated temperatures (42°C) to mimic thermophilic conditions

  • Cell-free expression systems:

    • PURE system supplemented with thermostable components

    • Allows precise control of redox environment and cofactors

    • Suitable for smaller-scale analytical studies

Each expression system requires optimization of induction parameters, including temperature shifts, inducer concentration, and harvest timing to maximize active enzyme yield.

How can I verify the correct folding of recombinant K. olearia CobS?

Verifying proper folding of recombinant K. olearia CobS requires multi-parameter analysis focusing on structural integrity and functional activity:

Structural verification methods:

  • Circular Dichroism (CD) spectroscopy:

    • Compare secondary structure content at different temperatures (25°C vs. 65°C)

    • Monitor thermal unfolding profiles to determine melting temperature

    • Expected result: Higher structural stability at elevated temperatures

  • Limited proteolysis:

    • Digest purified protein with proteases (trypsin, chymotrypsin) at varied temperatures

    • Analyze fragments by SDS-PAGE

    • Well-folded thermophilic proteins typically show resistance to proteolysis at higher temperatures

  • Size-exclusion chromatography:

    • Monitor oligomeric state at different temperatures

    • Analyze peak symmetry as indicator of homogeneous folding

Functional verification:

  • Enzyme activity assays at various temperatures (as described in section 2.1)

  • Correlation between activity and structural parameters from methods above

  • Comparison with activity of CobS from mesophilic organisms (e.g., S. typhimurium)

A well-folded K. olearia CobS should demonstrate maximum activity at temperatures aligned with the organism's growth optimum (approximately 65°C) and maintain structural integrity under these conditions.

How does the thermostability of K. olearia CobS impact its catalytic mechanism?

The thermostability of K. olearia CobS likely influences its catalytic mechanism through several interconnected factors:

Thermostability-activity relationship:

Temperature (°C)Expected Structural FeaturePredicted Impact on Catalysis
20-40Reduced conformational flexibilityLower activity due to limited induced fit
50-70Optimal balance of stability and dynamicsMaximal catalytic efficiency
75-85Onset of partial unfoldingDecreased specificity but continued activity
>85Progressive denaturationActivity loss

Thermophilic enzymes typically exhibit:

  • Slower catalytic rates at low temperatures due to reduced molecular motion

  • Higher activation energies but greater stability at elevated temperatures

  • Altered substrate binding dynamics, often with tighter binding but slower release kinetics

For K. olearia CobS specifically, the thermostability adaptations may include:

  • Increased rigidity in regions distant from the active site

  • Preservation of flexible loops necessary for substrate binding

  • Modified electrostatic interactions affecting transition state stabilization

Experimental approaches to investigate these relationships should include comparative enzyme kinetics across a temperature range (30-80°C), hydrogen-deuterium exchange mass spectrometry to map flexibility, and site-directed mutagenesis of predicted thermostability determinants.

What are the optimal conditions for crystallizing K. olearia CobS for structural studies?

Crystallizing thermophilic proteins like K. olearia CobS presents unique challenges and opportunities. The following methodological approach is recommended:

Pre-crystallization considerations:

  • Protein preparation:

    • Express with minimal tags (His6 preferred over larger tags)

    • Purify under anaerobic conditions to prevent oxidation

    • Verify homogeneity by dynamic light scattering

    • Consider limited proteolysis to remove flexible regions

  • Buffer optimization:

    • Screen buffers across pH 6.0-8.0 (with emphasis on pH 6.8, the physiological optimum)

    • Include stabilizing salts (25-30 g/L NaCl or equivalent ionic strength)

    • Test thermal stability in each buffer condition

Crystallization strategy:

  • Initial screening:

    • Perform parallel screens at multiple temperatures (4°C, 20°C, and 37°C)

    • Include both sparse matrix and systematic grid screens

    • Screen with and without potential ligands (adenosylcobinamide-GDP, α-ribazole-5′-phosphate)

  • Optimization parameters:

    • Temperature gradient crystallization

    • Addition of small molecule additives (especially osmolytes found in thermophiles)

    • Controlled dehydration of initial crystals

  • Specialized approaches:

    • Lipidic cubic phase crystallization if membrane association is suspected

    • Counter-diffusion methods for slower crystal growth

    • In situ proteolysis during crystallization

The optimal crystal-forming conditions will likely include moderate salt concentrations (resembling the natural habitat of K. olearia) and temperatures below the growth optimum but above typical mesophilic crystallization temperatures (approximately 30-45°C).

How can I design mutagenesis studies to investigate the thermostability mechanisms of K. olearia CobS?

Designing effective mutagenesis studies to investigate thermostability mechanisms requires systematic targeting of features typically associated with thermophilic adaptations:

Methodological approach to mutagenesis design:

  • Comparative sequence analysis:

    • Align K. olearia CobS with mesophilic homologs (e.g., from S. typhimurium)

    • Identify positions with characteristic thermophilic substitutions:

      • Charged residues replacing neutral ones

      • Increased proline content in loops

      • Reduced glycine content

      • Hydrophobic residues in core positions

  • Structure-guided targeting:

    • Create homology model based on available CobS structures

    • Target specific stabilizing features:

    Stabilizing FeatureMutation StrategyExpected Outcome
    Salt bridgesE/D/K/R to A substitutionsDecreased thermostability
    Hydrophobic coreI/L/V to A or G substitutionsReduced melting temperature
    Surface loopsInsertions or deletionsAltered flexibility/rigidity balance
    Helix cappingRemove/introduce N/C-terminal helix capsModified secondary structure stability
  • Iterative combination approach:

    • Generate single mutants first

    • Quantify ΔTm for each mutation using thermal shift assays

    • Combine stabilizing mutations in mesophilic CobS or destabilizing mutations in K. olearia CobS

    • Assess additive vs. non-additive effects

  • Functional assessment:

    • Compare activity profiles of mutants at different temperatures

    • Analyze trade-offs between thermostability and catalytic efficiency

    • Identify residues critical for thermostability but dispensable for catalysis

This systematic approach will help delineate specific molecular mechanisms underlying the thermostability of K. olearia CobS and potentially inform protein engineering efforts for other thermophilic enzymes.

How can I resolve aggregation issues with recombinant K. olearia CobS during purification?

Aggregation of recombinant thermophilic proteins like K. olearia CobS during purification commonly results from improper folding or exposure to non-native conditions. The following methodological solutions address these challenges:

Prevention strategies during expression:

  • Lower induction temperature (28-30°C) to slow protein synthesis

  • Reduce inducer concentration for more gradual expression

  • Co-express molecular chaperones (GroEL/ES, DnaK/DnaJ/GrpE)

  • Add osmolytes to growth medium (0.5-1M sorbitol or 5-10% glycerol)

Purification optimization protocol:

  • Cell lysis:

    • Perform at physiologically relevant temperatures (40-50°C)

    • Include specific stabilizers in lysis buffer:

      • Higher salt concentration (300-500 mM NaCl)

      • Mild detergents (0.1% Triton X-100 or 0.5% CHAPS)

      • Osmolytes (trehalose, glycine betaine at 0.5-1M)

  • Solubilization of inclusion bodies (if necessary):

    • Mild solubilization using arginine (0.5-1M) instead of urea/guanidine

    • On-column refolding with decreasing denaturant gradient

    • Temperature-assisted refolding at 40-50°C

  • Chromatography modifications:

    • Perform initial capture steps at elevated temperatures (35-45°C)

    • Include 10% glycerol in all purification buffers

    • Utilize hydrophobic interaction chromatography at higher temperatures

    • Consider thermostable affinity tags (Sulfolobus solfataricus Sso7d domain)

  • Final polishing:

    • Size-exclusion chromatography with in-line multi-angle light scattering

    • Thermal clarification step (heating at 55-60°C to precipitate contaminants)

    • Centrifugal ultrafiltration rather than precipitation for concentration

Monitoring protein quality throughout purification using dynamic light scattering provides early detection of aggregation tendencies and allows for real-time optimization of conditions.

What strategies can overcome low enzymatic activity of purified recombinant K. olearia CobS?

Low enzymatic activity in purified recombinant K. olearia CobS may result from multiple factors including improper folding, missing cofactors, or suboptimal assay conditions. A systematic troubleshooting approach includes:

Protein quality assessment:

  • Verify protein integrity by mass spectrometry

  • Assess oligomeric state by size-exclusion chromatography

  • Confirm secondary structure by circular dichroism spectroscopy

  • Test thermal stability profile using differential scanning fluorimetry

Reactivation strategies:

  • Thermal activation:

    • Heat-treat purified enzyme (60-65°C for 15-30 minutes)

    • Slowly cool to assay temperature

    • Include stabilizers during heating (glycerol, reducing agents)

  • Cofactor supplementation:

    • Add potential metal cofactors (Mg²⁺, Mn²⁺, Fe²⁺) at 1-5 mM

    • Include potential organic cofactors (ATP, GTP) at 0.5-2 mM

    • Test thermally labile cofactors by adding them after thermal activation

  • Environment optimization:

    • Screen buffer compositions across pH 5.5-8.0

    • Test ionic strength variations (10-60 g/L NaCl equivalent)

    • Include reducing agents (DTT, TCEP, or 2-mercaptoethanol)

    • Add molecular crowding agents (PEG, dextran)

Assay modifications:

  • Temperature gradient activity assessment (30-80°C)

  • Extended incubation times to account for slower kinetics

  • Alternative detection methods with higher sensitivity

  • Coupled enzyme assays to drive equilibrium toward product formation

If all reactivation attempts fail, consider co-expression with enzyme-specific chaperones or expression of the complete cobalamin biosynthesis pathway to ensure proper assembly of multi-enzyme complexes that may be necessary for full activity.

How can isotopic labeling be optimized for NMR studies of K. olearia CobS?

Isotopic labeling of thermophilic proteins like K. olearia CobS for NMR studies presents unique challenges due to their size, stability, and expression characteristics. The following methodological approach optimizes labeling efficiency while maintaining protein quality:

Expression optimization for isotopic labeling:

  • Selection of expression system:

    • E. coli BL21(DE3) remains preferred for isotopic labeling despite thermophilic origin

    • Consider E. coli strains with reduced metabolic scrambling (e.g., HMS174)

    • For challenging cases, cell-free expression systems offer advantages despite higher cost

  • Media formulation strategies:

    Labeling TypeMedia CompositionSpecial Considerations
    ¹⁵N uniformM9 minimal media with ¹⁵NH₄ClSupplement with micronutrients; higher concentration (1.5-2g/L) may improve yields
    ¹³C uniformM9 with ¹³C-glucoseUse 2-3g/L glucose; consider glycerol co-feeding to reduce metabolic burden
    ¹³C,¹⁵N uniformM9 with both isotopesExtend growth time; OD₆₀₀ before induction should reach 0.6-0.8
    Selective labelingDefined media with specific labeled amino acidsInclude excess unlabeled amino acids to prevent scrambling
    DeuterationD₂O-based M9 mediaImplement adaptive strategy with increasing D₂O percentages
  • Growth and induction protocol:

    • Use longer pre-induction growth at 37°C

    • Induce at lower OD₆₀₀ (0.6) than typical recombinant expression

    • Shift to 30°C upon induction

    • Extend expression time to 16-20 hours with lower IPTG concentration (0.2-0.3 mM)

  • Purification considerations:

    • Minimize exposure to H₂O for deuterated samples

    • Include protease inhibitors throughout purification

    • Concentrate samples to 0.3-0.5 mM for NMR studies

    • Buffer in 50 mM phosphate, pH 6.8 with 25-30 g/L NaCl

NMR experimental strategy:

  • Begin with ¹⁵N-HSQC at various temperatures (30-65°C) to determine optimal measurement conditions

  • For larger domains, employ TROSY methods at high field strengths

  • Consider segmental labeling if full-length protein exceeds practical size limits

  • Perform all measurements at temperatures reflecting the physiological range of K. olearia (preferably 50-60°C)

This optimized approach balances the requirements for efficient isotopic incorporation while maintaining the structural integrity of the thermophilic K. olearia CobS protein.

How does the cobalamin synthesis pathway in K. olearia compare to other Thermotogales?

Comparative analysis of cobalamin synthesis pathways across Thermotogales reveals important evolutionary adaptations and metabolic strategies:

Pathway comparison across Thermotogales:

OrganismDe novo SynthesisCobinamide SalvageKey Enzymes PresentUnique Features
K. oleariaLikely incompleteLikely presentPredicted CobS, partial pathway componentsGrowth at lower temperatures than other Thermotogales
T. lettingaeAbsentPresentCobS confirmedProduces B₁₂ only with cobinamide supplementation
T. maritimaAbsentAbsentLimited pathway enzymesCannot produce B₁₂ even with cobinamide
T. africanusLimitedPresentMultiple pathway enzymesIntermediate pathway completeness

The genomic evidence suggests Thermotogales generally lack complete de novo cobalamin synthesis capability. T. lettingae exemplifies this pattern, requiring exogenous cobinamide but possessing the salvage pathway enzymes including CobS to complete B₁₂ synthesis .

K. olearia's unique physiological characteristics, including unprecedented growth at low temperatures for Thermotogales , may correlate with adaptations in its cobalamin synthesis machinery. These adaptations could include:

  • Enhanced substrate promiscuity in salvage enzymes like CobS

  • Temperature-tuned enzyme kinetics matching broader growth range

  • Altered regulation of B₁₂-dependent metabolic pathways

The evolutionary pattern suggests ancestral Thermotogales likely possessed the salvage pathway, with subsequent loss in some lineages and retention with modification in others. This differential retention likely reflects ecological adaptation to habitats with varying availability of corrinoid precursors.

What are the key differences between mesophilic and thermophilic CobS proteins in substrate binding?

Thermophilic enzymes like K. olearia CobS typically exhibit distinct substrate binding characteristics compared to their mesophilic counterparts, driven by adaptations for function at elevated temperatures:

Comparative substrate binding characteristics:

The substrate binding site for adenosylcobinamide-GDP and α-ribazole-5′-phosphate in K. olearia CobS likely evolved specific adaptations to maintain appropriate geometry and electrostatic interactions at elevated temperatures, potentially including increased aromatic stacking interactions and strategic placement of charged residues to compensate for weakened hydrogen bonding at high temperatures.

How can evolutionary analysis of CobS across thermophiles inform protein engineering efforts?

Evolutionary analysis of CobS across thermophiles provides valuable insights for protein engineering efforts aimed at enhancing thermostability or catalytic properties:

Methodological approach to evolutionary analysis:

  • Phylogenetic mapping of thermal adaptation:

    • Construct maximum likelihood phylogeny of CobS sequences across temperature optima

    • Identify independent instances of thermal adaptation

    • Map thermostability-associated substitutions on phylogenetic tree

  • Ancestral sequence reconstruction:

    • Infer ancestral sequences at key adaptation nodes

    • Identify convergent mutations across multiple thermophilic lineages

    • Synthesize and characterize ancestral proteins to track stability/function trade-offs

  • Sequence-structure-function correlation:

    • Analyze correlation between growth temperature optima and specific sequence features

    • Identify co-evolving amino acid networks using methods like Statistical Coupling Analysis

    • Determine signature patterns distinguishing hyperthermophilic from moderately thermophilic CobS variants

Engineering applications from evolutionary insights:

  • Rational design strategies:

    Evolutionary PatternEngineering StrategyExpected Outcome
    Conserved charged residues in thermophilesIntroduction of novel salt bridgesEnhanced thermostability
    Thermophile-specific loop modificationsLoop shortening or rigidificationReduced entropy of unfolding
    Hyperthermophile core packing motifsIntroduction of specific hydrophobic clustersImproved core stability
    Surface charge distribution patternsOptimization of surface electrostaticsEnhanced solubility at high temperatures
  • Directed evolution approaches informed by natural selection:

    • Design focused libraries targeting positions with high evolutionary rates

    • Implement parallel selections at increasing temperatures

    • Apply epistasis-aware combinatorial approaches based on co-evolution data

  • Domain swapping and chimera design:

    • Swap thermostability-determining regions between mesophilic and thermophilic CobS

    • Create chimeric enzymes with optimized combinations of stability and activity

    • Test activity-stability trade-offs across temperature ranges

By leveraging evolutionary patterns observed in natural thermophile diversity, particularly focusing on K. olearia's position within Thermotogales, protein engineers can develop more effective strategies for enhancing thermostability while maintaining or improving catalytic efficiency of CobS and related enzymes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.