Recombinant Kynurenine 3-monooxygenase (CBG23368)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Kynurenine 3-Monooxygenase (CBG23368)

Recombinant Kynurenine 3-Monooxygenase (CBG23368) is a recombinant protein form of the enzyme kynurenine 3-monooxygenase, which plays a crucial role in the kynurenine pathway of tryptophan metabolism. This pathway is significant in various physiological and pathological processes, including neurodegenerative diseases and inflammation. The recombinant form of this enzyme is often used in research to study its function and potential therapeutic applications.

Function and Role of Kynurenine 3-Monooxygenase

Kynurenine 3-monooxygenase is an enzyme responsible for the conversion of kynurenine into 3-hydroxykynurenine (3-HK), a neurotoxic compound that can contribute to oxidative stress and excitotoxicity in the brain . This enzyme is localized in the mitochondrial outer membrane of microglial cells and other immune cells, where it influences neuroinflammation and immune responses .

Recombinant Kynurenine 3-Monooxygenase (CBG23368) Characteristics

  • Gene Name: CBG23368

  • Host/Reactivities: Expressed in cell-free systems, which can include E. coli, yeast, baculovirus, or mammalian cells .

  • Purity: Greater than or equal to 85% as determined by SDS-PAGE .

  • Applications: Primarily used in research for studying enzyme function, metabolic pathways, and potential therapeutic targets.

Neurodegenerative Diseases

Inhibition of kynurenine 3-monooxygenase has been explored as a therapeutic strategy for neurodegenerative diseases such as Alzheimer's, Huntington's, and Parkinson's diseases. By blocking this enzyme, the production of neurotoxic metabolites like 3-HK and quinolinic acid can be reduced, potentially alleviating disease symptoms .

Antiviral Properties

Recent studies have also highlighted the antiviral potential of kynurenine 3-monooxygenase and its metabolites. Quinolinic acid, a downstream product of the kynurenine pathway, can induce interferon production and inhibit viral infections .

Inflammation and Immune Response

Kynurenine 3-monooxygenase plays a role in modulating inflammation and immune responses. Its activity can influence the production of pro-inflammatory and anti-inflammatory metabolites, impacting disease outcomes .

Data and Tables

While specific data tables for Recombinant Kynurenine 3-Monooxygenase (CBG23368) are not readily available, the following table summarizes key aspects of kynurenine 3-monooxygenase and its relevance to various diseases:

Disease/ConditionRole of Kynurenine 3-MonooxygenasePotential Therapeutic Approach
Alzheimer's DiseaseContributes to neurotoxicity through 3-HK and QA production .Inhibition of KMO to reduce neurotoxic metabolites .
Huntington's DiseaseSimilar to Alzheimer's, contributes to neurotoxicity .Inhibition of KMO to increase neuroprotective kynurenic acid .
Parkinson's DiseaseInvolved in neuroinflammation and neurotoxicity .Inhibition of KMO to reduce neurotoxic metabolites and improve symptoms .
Viral InfectionsExhibits antiviral properties through QUIN-induced IFN production .Utilization of KMO or its metabolites as antiviral agents .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
kmo-1; CBG23368; Kynurenine 3-monooxygenase; Kynurenine 3-hydroxylase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-461
Protein Length
full length protein
Species
Caenorhabditis briggsae
Target Names
kmo-1
Target Protein Sequence
MPSVAIAGAGLVGALNACFFAQKGWDVSVYEFRKDIRTMKHVQGRSINLALSQRGKSALE AVGLKEYIVNQGVPLYARLVHNKDGKTYSRQPYGKPGEHIVSINRRHLNEVMITQAEKSP NVKFFFEHKVKSVDYDKKQLVVQCTSQPSRIPTFGTKSPPAEHEEFHVEADLIIACDGAY SAVRRSLMTIPRFDFSQEYIEHGYVELNIMANNNEFAFEENVFHLWPRGHFTLIALANRD KTFTVTIFAPFTEFEKHMSTTEEVLSFFEENFPDAYLLLGKEHIADTFNRVKPQSLVSIK CSPHSFFNNLVLMGDAAHAMVPFYGQGMNCGFEDCLVFSETLEEQNNDIASAVQVYSERR VNDAHTINDLAMYNYEELKDLVNKNSYKLRKKFDGFMNAIFPKSWIPLYSMVTFTRIPYS EVVDRRRKQDRILSNLWKTTSTLALIGAAIGIYSNRGRLGL
Uniprot No.

Target Background

Function

Catalyzes the hydroxylation of L-kynurenine (L-Kyn) to form 3-hydroxy-L-kynurenine (L-3OHKyn). This enzyme is essential for quinolinic acid biosynthesis.

Database Links

KEGG: cbr:CBG23368

STRING: 6238.CBG23368

Protein Families
Aromatic-ring hydroxylase family, KMO subfamily
Subcellular Location
Mitochondrion. Membrane; Multi-pass membrane protein.

Q&A

What is Kynurenine 3-Monooxygenase and its metabolic significance?

Kynurenine 3-Monooxygenase (KMO) is a critical enzyme in the kynurenine pathway of tryptophan metabolism. It catalyzes the hydroxylation of kynurenine to 3-hydroxykynurenine, representing a key branch point in this metabolic pathway. The enzyme plays a crucial role in regulating the balance between neuroprotective metabolites like kynurenic acid (KYNA) and potentially neurotoxic compounds such as quinolinic acid (QUIN). Research indicates that KMO deletion significantly alters the kynurenine metabolite profile, with KMO-null animals exhibiting dramatically elevated levels of kynurenine (up to 45-fold increase) and KYNA (up to 26-fold increase), while showing substantially reduced levels of QUIN (up to 95% decrease) . These metabolic changes make KMO a potential therapeutic target for conditions associated with dysregulated tryptophan metabolism.

How does KMO interact with its substrates and what mechanisms drive its catalytic activity?

KMO follows the induced fit model of enzyme-substrate interaction rather than a simple lock-and-key mechanism. When kynurenine binds to the active site of KMO, the enzyme undergoes a conformational change that optimizes the binding arrangement between the enzyme and the transition state of the substrate. This dynamic interaction lowers the activation energy required for the hydroxylation reaction to proceed .

The enzyme creates an optimal microenvironment within its active site, positioning the substrate in the precise orientation needed for the hydroxylation reaction. KMO brings the kynurenine substrate and molecular oxygen together in the optimal spatial arrangement, facilitating the transfer of oxygen to the substrate at the C3 position. The enzyme may also provide specific chemical groups that form temporary covalent bonds with the substrate during the reaction process, although these bonds are always broken as the enzyme returns to its original state after catalysis .

What expression systems are optimal for producing recombinant KMO, and what protocols yield the highest activity?

For recombinant KMO production, E. coli is a commonly used expression system due to its rapid growth, high protein yield, and ease of genetic manipulation . The general protocol involves:

  • Gene Cloning: The KMO gene (kmo-1 for CBG23368) is isolated and inserted into an appropriate expression vector with a His-tag for purification.

  • Transformation: The recombinant vector is introduced into competent E. coli cells through heat shock or chemical treatment.

  • Expression: Transformed cells are cultured under optimized conditions (temperature, induction time, media composition) to maximize protein expression .

For KMO specifically, expression conditions must be carefully optimized as the enzyme contains multiple domains and may require proper folding. While E. coli is commonly used, researchers should consider that:

  • Eukaryotic expression systems (yeast, insect, or mammalian cells) may better preserve enzyme activity for complex proteins like KMO

  • Co-expression with chaperones may improve folding and solubility

  • Expression at lower temperatures (16-20°C) after induction often yields higher amounts of soluble, active enzyme

The recombinant protein should be purified under conditions that maintain its native conformation, typically using immobilized metal affinity chromatography (IMAC) for His-tagged proteins, followed by additional purification steps like ion exchange or size exclusion chromatography .

What are the optimal storage and handling conditions for maintaining KMO activity?

To maintain optimal activity of recombinant KMO, the following storage and handling conditions are recommended:

  • Storage Buffer: Store in Tris/PBS-based buffer containing 6% trehalose at pH 8.0 .

  • Storage Temperature: Store at -20°C to -80°C for long-term preservation. Working aliquots can be kept at 4°C for up to one week .

  • Aliquoting: Divide the purified enzyme into small aliquots before freezing to avoid repeated freeze-thaw cycles, which significantly reduce enzyme activity.

  • Reconstitution: Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Addition of glycerol to a final concentration of 50% is recommended for long-term storage .

  • Freeze-Thaw Cycles: Repeated freezing and thawing should be strictly avoided as this dramatically decreases enzyme activity .

  • Handling: Briefly centrifuge vials before opening to bring contents to the bottom of the tube.

Researchers should validate enzyme activity after storage using appropriate assays to ensure the enzyme remains functional for experimental use.

How does genetic deletion or inhibition of KMO affect the broader kynurenine pathway and downstream metabolites?

Genetic deletion of KMO results in significant alterations throughout the kynurenine pathway, with complex effects on multiple metabolites. Based on studies comparing KMO wildtype (WT) and KMO null (NULL) mice:

MetaboliteEffect in KMO NULL vs. WT (Chow Diet)Effect in KMO NULL vs. WT (High-Fat Diet)
Kynurenine24-fold increase (P<0.001)45-fold increase (P<0.001)
Kynurenic Acid (KYNA)26-fold increase (P<0.001)20-fold increase (P<0.001)
Quinolinic Acid (QUIN)95% decrease (P=0.003)68% decrease (P=0.001)
Anthranilic AcidElevatedElevated
3-Hydroxyanthranilic Acid10-fold decrease (P=0.01)6-fold decrease (P=0.061)
3-HydroxykynurenineReducedReduced
Picolinic AcidReducedReduced
Xanthurenic AcidReducedReduced

The data indicate that KMO deletion creates a metabolic bottleneck in the kynurenine pathway, shunting metabolism toward KYNA production while severely limiting production of 3-hydroxykynurenine and its downstream products. Interestingly, the alternative branch through anthranilic acid becomes more active but fails to compensate for the loss of the primary KMO-dependent pathway to QUIN .

These metabolic changes have potential physiological implications, as KYNA and QUIN have opposing effects on glutamatergic neurotransmission, and several metabolites in this pathway influence energy metabolism and inflammation. The data suggest that complete KMO inhibition could have complex physiological effects beyond the anticipated reduction in potentially neurotoxic compounds .

What methodological approaches can enhance KMO enzymatic yield and activity?

Several methodological approaches can be employed to enhance KMO enzymatic yield and activity:

  • Rational Design: Using computational tools to predict beneficial mutations based on structural analysis of the enzyme's active site and substrate binding regions. This approach can improve catalytic efficiency by optimizing the spatial arrangement of key amino acid residues .

  • Directed Evolution: Employing iterative rounds of random mutagenesis followed by screening or selection for enhanced properties. This approach doesn't require detailed knowledge of structure-function relationships and can identify beneficial mutations that might not be predicted rationally .

  • Protein Engineering: Making targeted modifications to improve stability, such as:

    • Disulfide bridge introduction to enhance thermostability

    • Surface charge optimization to improve solubility

    • Removal of proteolytic cleavage sites

    • Glycosylation site engineering for mammalian expression systems

  • Expression Optimization:

    • Codon optimization for the expression host

    • Use of stronger promoters or inducible systems

    • Co-expression with molecular chaperones

    • Fusion with solubility-enhancing tags

  • Machine Learning Approaches: Recent advances in machine/deep learning have improved the accuracy of predicting beneficial mutations. These computational methods can identify functionally significant positions and map energetically and structurally allowed variations before experimental validation .

The most effective strategy often combines multiple approaches, using computational predictions to guide experimental design, followed by iterative optimization based on experimental results.

How can researchers study the induced fit model in KMO-substrate interactions?

Studying the induced fit model in KMO-substrate interactions requires a combination of structural, computational, and enzymatic approaches:

  • X-ray Crystallography: Obtain crystal structures of KMO in both the apo (unbound) state and in complex with substrates or substrate analogs. Comparing these structures can reveal conformational changes that occur upon substrate binding.

  • Molecular Dynamics Simulations: Perform computational simulations to model the dynamic behavior of KMO during substrate binding, which can reveal transient conformational states not captured in static crystal structures .

  • Site-Directed Mutagenesis: Systematically mutate residues in the active site and substrate binding regions to understand their roles in the induced fit mechanism. Mutations that affect the enzyme's flexibility but preserve catalytic residues can specifically test the importance of conformational changes.

  • Enzyme Kinetics with Various Substrates: Compare kinetic parameters (KM, kcat, kcat/KM) for the natural substrate and structural analogs. Substrates that induce different degrees of conformational change should show distinctive kinetic profiles.

  • Nuclear Magnetic Resonance (NMR): For smaller enzyme domains, NMR can provide valuable information about protein dynamics during substrate binding in solution.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): This technique can identify regions of the protein that undergo changes in solvent accessibility or hydrogen bonding upon substrate binding, providing insights into conformational changes associated with induced fit.

By integrating these approaches, researchers can develop a comprehensive understanding of how KMO dynamically responds to substrate binding, creating an optimal environment for catalysis that lowers the activation energy for the hydroxylation reaction .

What are the implications of altering KMO activity for metabolic and neurological disorders?

Altering KMO activity has significant implications for both metabolic and neurological disorders due to its central role in the kynurenine pathway. Research with KMO NULL mice has revealed:

Researchers should note that the effects of pharmacological KMO inhibition may differ from those of genetic deletion, particularly if inhibition is partial or acute rather than complete and chronic. Additionally, species differences in the kynurenine pathway may limit the translational relevance of findings from mouse models to humans .

How do techniques in enzyme design apply specifically to optimizing KMO for research applications?

Enzyme design techniques can be strategically applied to optimize KMO for specific research applications:

  • Stability Enhancement: KMO, like many enzymes, may have limited stability under experimental conditions. Computational design can identify stabilizing mutations that preserve catalytic activity while extending the enzyme's functional lifetime. This is particularly important for structural studies and high-throughput screening applications.

  • Substrate Specificity Modification: Using rational design or directed evolution, researchers can engineer KMO variants with altered substrate preferences. This can be valuable for:

    • Developing KMO variants that accept fluorogenic or chromogenic substrates for easier activity monitoring

    • Creating KMO variants that can process synthetic substrates for biotechnological applications

    • Engineering substrate specificity to investigate structure-function relationships

  • Expression Optimization: For research requiring large amounts of active enzyme, protein engineering can improve expression yields. This might involve:

    • Identification and removal of problematic sequence elements that limit expression

    • Domain swapping with homologous enzymes from other species to improve expression while maintaining catalytic function

    • Surface engineering to increase solubility

  • Cofactor Dependence Modification: KMO requires specific cofactors for activity. Enzyme design could potentially modify cofactor specificity or improve cofactor binding affinity, increasing catalytic efficiency.

  • Creation of Biosensors: KMO could be engineered into biosensors for detecting kynurenine or related metabolites by coupling conformational changes upon substrate binding to detectable signals (fluorescence, bioluminescence).

These applications require iterative cycles of computational design, experimental validation, and refinement. Recent advances in machine learning approaches have significantly improved the prediction accuracy for beneficial mutations, reducing the experimental burden of screening large numbers of variants .

What are common challenges in working with recombinant KMO and how can they be addressed?

Researchers working with recombinant KMO often encounter several technical challenges:

  • Low Expression Yields:

    • Challenge: KMO is a complex enzyme that may not express well in heterologous systems.

    • Solution: Optimize codon usage for the expression host, try different expression vectors with varying promoter strengths, and test expression in multiple hosts (E. coli, yeast, insect cells). Co-expression with molecular chaperones can also improve yield of correctly folded protein .

  • Poor Solubility:

    • Challenge: Recombinant KMO often forms inclusion bodies in bacterial expression systems.

    • Solution: Express at lower temperatures (16-20°C), reduce inducer concentration, or use solubility-enhancing fusion tags (SUMO, MBP, TRX). Alternatively, develop effective refolding protocols if working with inclusion bodies .

  • Enzyme Instability:

    • Challenge: KMO may lose activity quickly during purification and storage.

    • Solution: Include stabilizing agents (glycerol, trehalose) in buffers, avoid freeze-thaw cycles by storing in small aliquots, and consider engineering stabilized variants .

  • Assay Limitations:

    • Challenge: Measuring KMO activity can be difficult due to spectral interference or limited sensitivity.

    • Solution: Develop HPLC-based assays for direct measurement of product formation, or use coupled enzymatic assays that produce more easily detectable signals.

  • Cofactor Requirements:

    • Challenge: KMO requires specific cofactors that may be expensive or unstable.

    • Solution: Optimize cofactor concentrations, investigate cofactor regeneration systems for cost efficiency, or supplement reaction mixtures with stabilizing agents for labile cofactors.

  • Heterogeneity in Protein Preparations:

    • Challenge: Recombinant KMO preparations may contain a mixture of active and inactive forms.

    • Solution: Implement additional purification steps (size exclusion chromatography, ion exchange) to isolate the active fraction, and develop activity-based enrichment methods.

By systematically addressing these challenges, researchers can significantly improve the quality and consistency of their recombinant KMO preparations, enhancing experimental reproducibility and enabling more advanced studies of enzyme function and application.

How can researchers validate the structural integrity and activity of their recombinant KMO preparations?

Comprehensive validation of recombinant KMO requires assessing both structural integrity and enzymatic activity through multiple complementary approaches:

  • Structural Validation:

    • SDS-PAGE: Confirm protein purity (>90% recommended) and molecular weight (approximately 55 kDa including His-tag) .

    • Western Blot: Verify identity using antibodies against KMO or the His-tag.

    • Mass Spectrometry: Confirm primary structure and identify any post-translational modifications or proteolytic processing.

    • Circular Dichroism (CD): Assess secondary structure content to verify proper folding.

    • Dynamic Light Scattering (DLS): Check for aggregation and determine the oligomeric state.

  • Functional Validation:

    • Enzyme Kinetics: Determine Michaelis-Menten parameters (KM, Vmax) using kynurenine as substrate. Compare with published values for natural or recombinant KMO.

    • Substrate Specificity: Test activity with kynurenine analogs to confirm expected specificity patterns.

    • Cofactor Requirements: Verify dependence on expected cofactors (NAD(P)H, FAD) and optimal cofactor concentrations.

    • Inhibitor Sensitivity: Confirm responsiveness to known KMO inhibitors at expected IC50 values.

  • Stability Assessment:

    • Thermal Stability: Determine the melting temperature (Tm) using differential scanning fluorimetry (DSF) or CD.

    • pH Stability Profile: Measure activity after incubation at various pH values.

    • Storage Stability: Assess activity retention over time under different storage conditions.

    • Operational Stability: Evaluate activity during extended reaction times or after multiple reaction cycles.

  • Advanced Characterization:

    • Ligand Binding Studies: Use isothermal titration calorimetry (ITC) or microscale thermophoresis (MST) to measure binding affinities for substrates and inhibitors.

    • Product Analysis: Confirm formation of the expected product (3-hydroxykynurenine) using HPLC, LC-MS, or other analytical methods.

Establishing a comprehensive validation protocol ensures that experimental results can be confidently attributed to KMO activity rather than contaminants or structural artifacts. Documentation of these validation parameters also enhances reproducibility across different batches of recombinant enzyme and between different laboratories.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.