Recombinant Kynurenine 3-monooxygenase (R07B7.5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
kmo-1; R07B7.5; Kynurenine 3-monooxygenase; Kynurenine 3-hydroxylase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-461
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
kmo-1
Target Protein Sequence
MPSVAIAGAGLVGALNACFFAQKGWDVSVYEFRKDIRTMKHVQGRSINLALSQRGKSALE AVGLKEYIVNQGVPLYARLIHNKDGKTYSRQPYGKPGEHIVSINRRHLNEVMITQAEKSP NVKFFFEHKVKNVDYDKKQLVVQCTSQPSKIPTFGNKSPPQEHAEFHVEADLILACDGAY SAVRRSLMTIPRFDFSQEYIEHGYVELNIMANNNEFAFEENVFHLWPRGHFTLIALANRD KTFTVTIFAPFSEFEKHMSTSEDVLSFFEENFPDAFLLLGKEHIADTFNRVKPQPLVSIK CSPHSFFDNLVLMGDAAHAMVPFYGQGMNCGFEDCLVFSETLEEYGNDIAKAVKVYSDGR VNDAHSINDLAMYNYEELKDLVNKSSYKLRKKFDTIMNSIFPKSWIPLYSMVTFSRIPYS EVIERRKRQDKILSRIMTTTSTLALIGAAAGIYVNRGKLGL
Uniprot No.

Target Background

Function

Catalyzes the hydroxylation of L-kynurenine (L-Kyn) to form 3-hydroxy-L-kynurenine (L-3OHKyn). This enzyme is essential for quinolinic acid synthesis.

Database Links

KEGG: cel:CELE_R07B7.5

STRING: 6239.R07B7.5

UniGene: Cel.2875

Protein Families
Aromatic-ring hydroxylase family, KMO subfamily
Subcellular Location
Mitochondrion. Membrane; Multi-pass membrane protein.

Q&A

What is Kynurenine 3-monooxygenase and what is its role in metabolic pathways?

Kynurenine 3-monooxygenase (KMO), also known as kynurenine 3-hydroxylase, is a critical enzyme in the kynurenine pathway of tryptophan degradation. It catalyzes the NADPH- and flavin adenine dinucleotide (FAD)-dependent 3-hydroxylation of kynurenine to 3-hydroxykynurenine (3-HK) . KMO functions as a gatekeeper enzyme that determines the metabolic fate of kynurenine, directing tryptophan metabolism toward the production of quinolinic acid . It is primarily located in the mitochondrial outer membrane of microglial cells in the brain and dendritic cells and macrophages in peripheral tissues .

How does KMO activity influence the balance of neurotoxic and neuroprotective metabolites?

KMO activity directly affects the balance between neurotoxic and neuroprotective metabolites in the kynurenine pathway. When KMO is active, metabolism is directed toward producing 3-hydroxykynurenine (3-HK) and subsequently quinolinic acid, both of which are neurotoxic . 3-HK generates neurotoxicity through hydrogen peroxide production, while quinolinic acid exerts excitotoxic effects . Conversely, inhibition or downregulation of KMO shifts the pathway flux toward the production of kynurenic acid (KYNA), which is neuroprotective . This metabolic shift creates a neuroprotective environment by reducing neurotoxic metabolites while increasing neuroprotective ones, making KMO a potential therapeutic target for neurodegenerative conditions .

What is the relationship between KMO and inflammatory responses?

KMO expression is upregulated during inflammatory responses, particularly in response to proinflammatory cytokines . This upregulation increases the flux through the neurotoxic branch of the kynurenine pathway, leading to elevated levels of 3-hydroxykynurenine and quinolinic acid . This metabolic shift during inflammation may contribute to neuroinflammatory and neurodegenerative processes. Research has shown that inhibition of KMO can reduce inflammatory-mediated tissue injury, suggesting a direct link between KMO activity and the progression of inflammatory diseases .

What are the optimal expression systems for producing functional recombinant KMO?

For functional recombinant human KMO production, insect cell expression systems have proven effective. According to research data, Spodoptera frugiperda Sf21 cells with baculovirus-derived expression have successfully produced active human KMO (spanning amino acids Asp2-Leu441), with an N-terminal Met and 6-His tag . This expression system appears to be effective because KMO is a membrane-bound protein that requires proper folding and post-translational modifications. Truncated versions that eliminate the C-terminal membrane-anchoring region while preserving catalytic activity are often used for structural and biochemical studies . When designing expression systems, researchers should consider that KMO is normally located in the mitochondrial outer membrane, which influences its proper folding and activity .

How can researchers assess KMO enzymatic activity in different experimental models?

KMO enzymatic activity can be assessed through multiple complementary approaches:

  • Substrate-Product Analysis: Measuring the conversion of kynurenine to 3-hydroxykynurenine using HPLC or LC-MS/MS, often coupled with detection of NADPH consumption .

  • Metabolite Profiling: Comprehensive analysis of kynurenine pathway metabolites to determine pathway flux. In KMO-null models, researchers typically observe:

    • Elevated kynurenine (up to 19-fold increase)

    • Depleted 3-hydroxykynurenine (below quantification limits)

    • Increased kynurenic acid (up to 81-fold increase)

    • Moderately increased anthranilic acid (approximately 4-fold increase)

    • Reduced 3-hydroxyanthranilic acid levels

  • Mutational Assays: Site-directed mutagenesis of key residues (such as the R380A mutation) followed by activity measurements to assess structure-function relationships .

  • Inhibitor Assays: Using specific KMO inhibitors and measuring changes in metabolite levels, such as rapid increases in circulating kynurenine and kynurenic acid following inhibitor administration .

What are the critical considerations when designing docking studies for KMO inhibitors?

When designing docking studies for KMO inhibitors, researchers should consider several critical factors:

  • Validation with Known Substrates: First validate the structural model by docking the natural substrate kynurenine. The carboxylic acid moiety of kynurenine should interact with the polar side of the binding pocket (particularly with R85), while the aniline moiety should dock on the hydrophobic side .

  • Binding Site Architecture: KMO has a distinct binding pocket with a polar region that accommodates the carboxylic acid group of substrates and a hydrophobic region that interacts with aromatic moieties. This dual nature of the binding pocket should be accounted for in docking simulations .

  • Role of Key Residues: While some residues like R380 may appear important based on structural analysis, functional studies have shown that mutations such as R380A have minimal effect on substrate recognition, highlighting the importance of experimental validation of computational predictions .

  • Dimerization Consideration: Functional KMO exists as a dimer, and mutations at the β-sheet dimer interface significantly reduce catalytic activity. Docking studies should consider the dimeric state and potential allosteric effects .

  • FAD Cofactor Interactions: KMO requires FAD as a cofactor, and the proximity of potential inhibitors to the FAD binding site is crucial for understanding mechanism of inhibition .

How does KMO inhibition affect neurodegenerative disease progression in animal models?

KMO inhibition has demonstrated significant neuroprotective effects in various neurodegenerative disease models:

  • Huntington's Disease: Inhibition of KMO in mouse models of Huntington's disease has been shown to reverse cognitive and motor deficits by increasing neuroprotective kynurenic acid levels . Specifically, compound 1b, a prodrug KMO inhibitor that crosses the blood-brain barrier, demonstrates neuroprotection in a Drosophila model of Huntington's disease by lowering levels of the toxic metabolite 3-hydroxykynurenine .

  • Alzheimer's Disease: Studies indicate that KMO inhibition can ameliorate pathology in Alzheimer's disease models, where increased levels of 3-hydroxykynurenine and quinolinic acid are typically observed in the brain .

  • Acute Pancreatitis with Multiple Organ Dysfunction: KMO inhibition prevents multiple organ failure in rodent models of acute pancreatitis. This protection is associated with profound changes in the kynurenine pathway metabolite profile, including increased protective metabolites .

  • Mechanism: The neuroprotective effects primarily occur through shifting the kynurenine pathway away from producing neurotoxic 3-hydroxykynurenine and quinolinic acid, toward generating neuroprotective kynurenic acid. This metabolic shift creates a neuroprotective environment in the brain that can slow or reverse disease progression .

What metabolic changes are observed in KMO knockout models and how do they relate to disease phenotypes?

KMO knockout models display distinct metabolic profiles with significant implications for disease phenotypes:

MetaboliteChange in KMO NULL vs. Wild TypeStatistical Significance
KynurenineIncreased 19-foldP < 0.001
3-HydroxykynurenineDepleted below quantification limitsP < 0.001
Kynurenic acidIncreased 81-foldP < 0.001
Anthranilic acidIncreased 4-foldP < 0.001
3-Hydroxyanthranilic acidDecreased ~45%P = 0.034

These metabolic alterations have several implications:

  • Neurodegenerative Protection: The significantly increased kynurenic acid combined with reduced neurotoxic metabolites creates a neuroprotective environment .

  • Energy Metabolism Effects: KMO null mice show changes in whole-body energy metabolism, though the exact impact is complex due to competing effects of elevated kynurenine (potentially obesogenic) and elevated kynurenic acid (potentially thermogenic) .

  • Alternative Pathway Utilization: Despite elevated anthranilic acid (an alternative route to produce quinolinic acid), the conversion to 3-hydroxyanthranilic acid appears limited, resulting in reduced neurotoxic quinolinic acid production .

  • Diet Interactions: KMO null animals show more pronounced metabolic changes in response to dietary interventions compared to wild-type animals, suggesting that KMO deficiency alters metabolic flexibility .

What challenges exist in translating KMO inhibition strategies from animal models to clinical applications?

Several significant challenges exist in translating KMO inhibition strategies to clinical applications:

  • Blood-Brain Barrier Penetration: Many KMO inhibitors do not efficiently cross the blood-brain barrier. Recent developments like prodrug 1b show promise by crossing the blood-brain barrier and releasing active compound 1 in the brain, but optimizing brain penetration remains challenging .

  • Systemic vs. Central Effects: KMO inhibition affects both peripheral and central kynurenine metabolism differently. Since KMO is expressed primarily in microglial cells in the brain and in immune cells in the periphery, systemic inhibition may have different consequences than central inhibition .

  • Complete vs. Partial Inhibition: Data from KMO null mice may only be translatable to humans under conditions of complete chemical KMO inhibition or in individuals with complete loss of KMO function. The metabolic effects of partial inhibition may differ significantly .

  • Long-term Consequences: Limited data exists on the long-term pharmacological manipulation of KMO in humans and resulting metabolic effects. As clinical trials with KMO inhibitors progress, more data will clarify the impact on whole-body energy metabolism in humans .

  • Tissue-Specific Effects: Bulk RNA-seq analyses may obscure specific cellular or subcellular changes due to tissue heterogeneity, complicating the understanding of KMO inhibition effects across different tissues .

How is the KMO gene conserved across different species and what are the functional implications?

KMO shows significant conservation across species, with important functional implications:

  • C. elegans: The R07B7.5 gene (kmo-1) encodes the C. elegans ortholog of human KMO and is predicted to have similar FAD-binding properties and enzymatic function in tryptophan metabolism . This conservation makes C. elegans a valuable model for studying KMO function.

  • Rodents: Rat KMO shows high structural and functional similarity to human KMO, including the dimeric structure critical for enzymatic activity. The β-sheet dimer interface is particularly conserved, with mutations at this interface significantly reducing catalytic activity .

  • Humans: Human KMO is expressed as a mitochondrial outer membrane protein that catalyzes the hydroxylation of L-kynurenine to form 3-hydroxy-L-kynurenine .

  • Functional Implications:

    • The high conservation of KMO suggests its fundamental importance in tryptophan metabolism across species

    • Conserved residues in the binding site (like R85) are critical for substrate recognition across species

    • The dimeric structure appears to be evolutionarily conserved and essential for function

    • Genetic variations in KMO have been linked to various conditions, including depression, with the rs1053230 polymorphism showing significant associations

What gene expression changes accompany KMO modulation in different tissue types?

KMO modulation leads to varied gene expression changes across different tissue types:

  • Adipose Tissue: Transcriptomic analysis of inguinal adipose tissue from KMO null mice showed minimal differences compared to wild-type mice, which may be due to tissue heterogeneity obscuring specific cellular changes. This suggests that the effects of KMO deficiency on adipose tissue may be more metabolic than transcriptional .

  • C. elegans Model: In C. elegans, while not directly studying KMO, research on the Werner syndrome (WRN-1) helicase mutant showed significant upregulation of several metabolic genes, including those involved in oxidation-reduction processes and lipid metabolism . The table below shows fold changes in gene expression:

GeneFold difference (RNA-seq)Fold difference (RT-PCR)P-value
sodh-1+10.79+8.09<0.001
gpx-3+6.21+3.240.0012
nas-3+4.51+3.43<0.001
daf-9+3.60+2.78<0.001
asah-1+3.06+1.650.0008
acs-2+3.30+3.48<0.001
  • Neurological Tissues: While specific transcriptomic data is limited in the provided information, KMO is known to be expressed in microglial cells in the brain. Modulation of KMO activity would likely affect expression of genes involved in neuroinflammation and neuroprotection pathways .

  • Immune Cells: As KMO is expressed in dendritic cells and macrophages in the periphery, its modulation would affect immune response genes, particularly those related to inflammation and cytokine production .

What structure-activity relationship insights guide the development of next-generation KMO inhibitors?

Development of next-generation KMO inhibitors is guided by several key structure-activity relationship (SAR) insights:

  • Binding Pocket Architecture: The KMO binding site consists of a polar region that accommodates the carboxylic acid group of substrates and a hydrophobic region that interacts with aromatic moieties. Effective inhibitors must address both regions .

  • Prodrug Approach for CNS Penetration: Brain-permeable inhibitors like compound 1b demonstrate that a prodrug approach can overcome the blood-brain barrier limitation. These prodrugs cross the barrier and release the active compound in the brain, lowering levels of toxic metabolites like 3-hydroxykynurenine .

  • Dimer Interface Considerations: The functional unit of KMO is a dimer, and mutations at the β-sheet dimer interface significantly reduce catalytic activity. Advanced inhibitors might target this interface for allosteric inhibition .

  • Key Residue Interactions: While structural analysis suggests R380 might be important for ligand binding, functional studies show the R380A mutation has no effect on kynurenine hydroxylation, indicating it does not play a major role in substrate recognition. This highlights the importance of experimental validation in determining critical binding interactions .

  • Pharmacokinetic Properties: Inhibitors with better pharmacokinetic properties show rapid increases in circulating kynurenine and kynurenic acid levels. For example, GSK180 treatment resulted in peak free drug levels in plasma (92 µM) that were >12-fold above the IC50 in cells, demonstrating effective target engagement .

How can researchers distinguish between direct effects of KMO inhibition and secondary metabolic consequences?

Distinguishing between direct effects of KMO inhibition and secondary metabolic consequences requires a multi-faceted approach:

  • Temporal Profiling: Monitoring the time course of metabolite changes following KMO inhibition can help differentiate primary from secondary effects. For example, GSK180 administration causes a rapid increase in circulating kynurenine and kynurenic acid that returns to baseline as drug levels drop . Interestingly, kynurenic acid peaks before kynurenine, suggesting complex regulatory mechanisms beyond simple substrate availability .

  • Pathway Bypass Assessment: Analyzing alternative pathway utilization by measuring metabolites like anthranilic acid (which can bypass KMO to produce quinolinic acid) helps distinguish direct KMO inhibition effects from compensatory mechanisms. Despite elevated anthranilic acid in KMO null animals, 3-hydroxyanthranilic acid remains reduced, indicating limited functional compensation through this alternative pathway .

  • Comparative Genetic and Pharmacological Models: Comparing metabolic profiles between genetic KMO knockout models and pharmacological KMO inhibition helps differentiate acute versus chronic adaptation effects. Differences observed may highlight secondary compensatory mechanisms that develop over time .

  • Tissue-Specific Analysis: Analyzing tissue-specific metabolite profiles rather than just systemic levels helps distinguish local from systemic effects of KMO inhibition. This is particularly important given KMO's differential expression in various tissues .

  • Challenge Tests: Examining how KMO null animals respond to dietary challenges compared to wild-type animals reveals metabolic flexibility alterations that may represent secondary adaptations rather than direct effects of KMO inhibition .

What are the implications of KMO inhibition for whole-body energy metabolism and metabolic diseases?

The implications of KMO inhibition for whole-body energy metabolism and metabolic diseases are complex and not fully understood:

What are the optimal storage and handling conditions for recombinant KMO to maintain enzymatic activity?

Recombinant KMO requires specific storage and handling conditions to maintain enzymatic activity due to its membrane-associated nature and dependence on cofactors:

  • Temperature Considerations: Purified recombinant KMO should be stored at -80°C for long-term storage, with aliquoting recommended to avoid repeated freeze-thaw cycles. For short-term use during experiments, 4°C is suitable with minimal activity loss over 24-48 hours .

  • Buffer Composition: Optimal buffer systems typically include:

    • 50 mM HEPES or phosphate buffer (pH 7.4-7.5)

    • 5-10% glycerol to stabilize protein structure

    • 1 mM EDTA to prevent metal-catalyzed oxidation

    • 1 mM DTT or other reducing agents to maintain thiol groups

    • Protease inhibitors to prevent degradation

  • Cofactor Addition: Since KMO is FAD-dependent, addition of FAD (typically 10-50 μM) to storage and reaction buffers helps maintain enzymatic activity. Similarly, NADPH should be freshly prepared and added immediately before activity assays .

  • Protein Concentration: Maintaining moderately high protein concentrations (0.5-2 mg/ml) during storage helps stabilize the enzyme structure and prevent activity loss .

  • Membrane Environment: As KMO is naturally a membrane-associated protein, addition of mild detergents or lipid mimetics in the buffer system can help maintain the proper protein conformation and activity .

How can researchers develop cell-based assays to evaluate KMO activity and inhibition?

Developing effective cell-based assays for KMO activity and inhibition requires careful consideration of several factors:

  • Cell Line Selection: Cells with endogenous KMO expression (such as microglia, macrophages, or dendritic cells) provide a physiologically relevant system. Alternatively, stable cell lines overexpressing KMO can be generated for higher throughput screening .

  • Metabolite Measurement Methods:

    • LC-MS/MS quantification of kynurenine consumption and 3-hydroxykynurenine production

    • Fluorescence-based assays measuring NADPH consumption

    • Immunoassays detecting specific kynurenine pathway metabolites

  • Assay Optimization Parameters:

    • Cell density (typically 10,000-50,000 cells/well)

    • Incubation time (4-24 hours depending on KMO expression levels)

    • Substrate concentration (kynurenine at 50-200 μM)

    • Controls (known KMO inhibitors as positive controls)

  • Validation Strategies:

    • Confirm KMO expression by Western blot or qPCR

    • Verify assay specificity using KMO knockdown or knockout cells

    • Establish dose-response relationships with known inhibitors

    • Calculate Z-factor to assess assay robustness

  • Data Analysis Approaches:

    • Normalize metabolite production to cell number or protein content

    • Calculate IC50 values for inhibitors

    • Consider developing a multiplex approach to measure multiple kynurenine pathway metabolites simultaneously

What considerations are important when designing experiments to study the role of KMO in neuroinflammatory processes?

When designing experiments to study KMO's role in neuroinflammatory processes, several key considerations are essential:

  • Model System Selection:

    • In vitro: Primary microglia, microglial cell lines (BV-2, N9), mixed glial cultures, or neuron-glia co-cultures

    • In vivo: KMO knockout models, inflammatory challenge models (LPS, cytokine injection), or disease-specific models (e.g., MPTP for Parkinson's disease)

    • Organism choice: While mouse models are common, C. elegans (with the kmo-1 ortholog) provides advantages for genetic manipulation and high-throughput screening

  • Inflammatory Stimulus Selection:

    • Type: LPS, TNF-α, IL-1β, IFN-γ, or disease-relevant stimuli

    • Dosage: Titration to determine optimal concentrations that induce KMO without excessive toxicity

    • Timing: Acute vs. chronic stimulation to differentiate immediate vs. adaptive responses

  • Measurement Parameters:

    • Kynurenine pathway metabolites: Comprehensive profiling including kynurenine, 3-hydroxykynurenine, kynurenic acid, anthranilic acid, 3-hydroxyanthranilic acid, and quinolinic acid

    • Inflammatory markers: Cytokine profiles, microglial activation markers, ROS production

    • Functional outcomes: Neuronal viability, electrophysiological parameters, behavioral assessments in animal models

  • Intervention Strategies:

    • Pharmacological: KMO inhibitors with consideration of blood-brain barrier penetration

    • Genetic: KMO knockdown/knockout, specific mutations of key residues

    • Timing of intervention: Preventive (before inflammatory stimulus) vs. therapeutic (after inflammation established)

  • Translational Considerations:

    • Species differences in kynurenine metabolism

    • Route of administration for CNS targeting

    • Acute vs. chronic effects of KMO modulation

    • Potential compensatory mechanisms through alternative pathways

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.