Recombinant Labrus ossifagus Alpha-2 adrenergic receptor

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Labrus ossifagus Alpha-2 Adrenergic Receptor

The Recombinant Labrus ossifagus Alpha-2 Adrenergic Receptor is a full-length protein corresponding to the native alpha-2 adrenergic receptor found in the cuckoo wrasse (Labrus ossifagus), a teleost fish species. Alpha-2 adrenergic receptors belong to the larger family of G-protein coupled receptors (GPCRs) characterized by their seven transmembrane domain structure, which are involved in mediating the effects of catecholamines throughout the vertebrate lineage. The recombinant form of this receptor has been expressed in heterologous systems, primarily Escherichia coli, to produce sufficient quantities for detailed molecular and pharmacological characterization .

The receptor was first cloned in the early 1990s, representing one of the first fish alpha-2 adrenergic receptors to be molecularly characterized. This receptor has become particularly valuable in comparative studies examining the evolution of adrenergic signaling systems across vertebrates, offering insights into both conserved and divergent features of this important receptor class. The recombinant protein typically includes a histidine tag to facilitate purification while maintaining the functional properties of the native receptor .

Comparative Sequence Analysis

Phylogenetic analysis positions this receptor as having characteristics intermediate between the mammalian alpha-2A and alpha-2C receptor subtypes, suggesting it may represent an ancestral form of these receptors. The receptor contains identifiable "molecular fingerprints" that are characteristic of this specific receptor subtype, particularly in the third intracellular loop region .

Table 1: Comparative Sequence Identity Between Labrus ossifagus and Human Alpha-2 Adrenergic Receptor Subtypes

Expression and Purification of the Recombinant Receptor

The recombinant form of the Labrus ossifagus Alpha-2 Adrenergic Receptor is typically produced using Escherichia coli expression systems. The full-length coding sequence (1-432 amino acids) is cloned into appropriate expression vectors, often incorporating a histidine tag to facilitate subsequent purification processes. The histidine tag allows for efficient purification using affinity chromatography techniques, resulting in preparations with greater than 90% purity as determined by SDS-PAGE analysis .

The purified recombinant protein is commonly supplied as a lyophilized powder in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0. This formulation enhances stability during storage and shipping. For experimental use, the lyophilized protein is reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with recommendations to add 5-50% glycerol (final concentration) for long-term storage. The addition of glycerol prevents damage from freeze-thaw cycles when stored at -20°C or -80°C .

For functional studies involving membrane-bound receptor preparations, the recombinant protein has also been successfully expressed in mammalian cell lines such as COS-7 cells, where it displays appropriate membrane localization and binding characteristics .

Native Receptor Function in Labrus ossifagus

In its native context within the cuckoo wrasse, the alpha-2 adrenergic receptor plays a crucial role in regulating pigment cell function. The receptor mediates nervous control of melanosome aggregation in melanophores (specialized pigment cells). Stimulation of the receptor, either by sympathetic nerve activation or by direct agonist application, triggers rapid aggregation of melanosomes, causing visible changes in skin pigmentation. This process is reversible, with melanosomes dispersing when receptor stimulation ceases .

The receptor's activity is mediated through coupling to the adenylate cyclase-cyclic AMP system of melanophores. Specifically, stimulation of the alpha-2 adrenergic receptors by noradrenaline is associated with a significant reduction in the cyclic AMP content of melanophores, suggesting a Gi/o protein-coupled signaling mechanism similar to that observed in mammalian alpha-2 adrenergic receptors .

Pharmacological Properties of the Recombinant Receptor

When expressed in heterologous systems, the recombinant Labrus ossifagus Alpha-2 Adrenergic Receptor exhibits pharmacological characteristics consistent with the alpha-2 adrenergic receptor family. Radioligand binding studies using [3H]-rauwolscine have demonstrated that the recombinant receptor binds this ligand with high affinity (KD of 0.8 ± 0.1 nM) and exhibits saturable binding with a Bmax of 5.7 ± 1.0 pmol/mg of protein .

Competition binding studies have established a pharmacological profile for the receptor, with the following rank order of potency:

  • For agonists: medetomidine > clonidine > p-aminoclonidine > B-HT 920 > (-)-noradrenaline

  • For antagonists: rauwolscine > atipamezole > yohimbine > phentolamine > prazosin

This pharmacological profile shows characteristics of both the human alpha-2C and alpha-2A receptor subtypes, supporting the hypothesis that the Labrus ossifagus receptor may represent an ancestral form of these receptor subtypes .

Evolutionary Significance in Adrenergic Receptor Research

The Recombinant Labrus ossifagus Alpha-2 Adrenergic Receptor has contributed significantly to our understanding of the evolution of adrenergic signaling systems in vertebrates. Comparative genomic studies involving this receptor and other fish alpha-2 adrenergic receptors have revealed important insights into the diversification of this receptor family through gene duplication events .

Research has demonstrated that the four major alpha-2 adrenergic receptor subtypes likely arose through two rounds of chromosome or block duplication that occurred before the divergence of ray-finned fish and tetrapod lineages. The Labrus ossifagus receptor appears to be orthologous to the alpha-2C subtype in mammals, though it shows some intermediate characteristics between alpha-2A and alpha-2C subtypes .

Of particular evolutionary significance is the identification of a fourth alpha-2 adrenergic receptor subtype in fish that is apparently absent or yet to be identified in mammals. This discovery, to which studies of the Labrus ossifagus receptor contributed, suggests that the ancestral vertebrate likely possessed four alpha-2 adrenergic receptor subtypes, with one subtype potentially being lost in the mammalian lineage .

Potential Regulation and Gene Structure

Analysis of the genomic sequence of the Labrus ossifagus Alpha-2 Adrenergic Receptor has revealed interesting features in the 5'-untranslated region that suggest potential regulatory mechanisms. Specific nucleotide sequences indicate that transcription of this receptor might be regulated by cyclic AMP, calcium, and/or steroid hormones, pointing to sophisticated control mechanisms for receptor expression that may respond to various physiological conditions .

Unlike many G-protein coupled receptors that contain introns in their coding sequences, the Labrus ossifagus Alpha-2 Adrenergic Receptor gene appears to have an intronless coding region, similar to the structure observed in mammalian alpha-2 adrenergic receptor genes. This conservation of gene structure further supports the evolutionary relationship between fish and mammalian adrenergic receptors .

Applications in Research and Biotechnology

The Recombinant Labrus ossifagus Alpha-2 Adrenergic Receptor has found several important applications in both basic research and biotechnological contexts:

  1. Comparative pharmacology studies examining the evolution of ligand binding properties across vertebrate species

  2. Structure-function analyses investigating conserved domains essential for adrenergic receptor function

  3. Drug discovery platforms seeking novel compounds with specificity for particular alpha-2 adrenergic receptor subtypes

  4. Model systems for studying G-protein coupled receptor signaling mechanisms

  5. Research tools for examining denervation supersensitivity phenomena, as demonstrated in studies showing dramatic increases in sensitivity following denervation of melanophores

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, kindly indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its inclusion in the development process.
Synonyms
Alpha-2 adrenergic receptor; Alpha-2 adrenoreceptor; Alpha-2 adrenoceptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-432
Protein Length
full length protein
Species
Labrus ossifagus (Cuckoo wrasse)
Target Protein Sequence
MDPLNATGMDAFTAIHLNASWSADSGYSLAAIASIAALVSFLILFTVVGNILVVIAVLTS RALKAPQNLFLVSLATADILVATLVMPFSLANELMGYWYFGKVWCGIYLALDVLFCTSSI VHLCAISLDRYWSVTQAVEYNLKRTPKRVKCIIVIVWLISAFISSPPLLSIDSNNYISSQ PQCMLNDDTWYILSSSMASFFAPCLIMILVYIRIYQVAKTRTRSMSGKEPRPDGVTQTEN GLNKANSPCHGDRENGHCQCPPTPSQRTVTIGQQTDDADMDESFSSEGKGHKPQRQDSQR AKRPGLKKSSISKQSARISRVSNKSVDLFASRRKRRRSSIAEKKVSQAREKRFTFVLAVV MGVFVVCWFPFFFSYSLHAVCRDYCKIPDTLFKFFWIGYCNSSLNPAIYTIFNRDFRRAF QKILCKSWKKSF
Uniprot No.

Target Background

Function
Alpha-2 adrenergic receptors mediate the catecholamine-induced inhibition of adenylate cyclase through the action of G proteins.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How was the Labrus ossifagus alpha-2 adrenergic receptor initially identified and cloned?

The Labrus ossifagus alpha-2 adrenergic receptor was initially identified through molecular cloning techniques focused on fish melanophore cells, where pigment granule aggregation is mediated by receptors with alpha-2 adrenergic pharmacology. The cloning methodology involved:

  • Design of degenerate oligonucleotide primers corresponding to conserved regions of human alpha-2 adrenergic receptor subtypes

  • PCR amplification using cDNA prepared from mRNA isolated from cuckoo wrasse skin

  • Identification of an 876 base pair product homologous to human alpha-2 adrenergic receptors

  • Screening of a genomic library from the cuckoo wrasse

  • Isolation of a clone (pTB17BS) containing approximately 5 kb of genomic DNA with the initial PCR product sequence

  • Identification of an open reading frame encoding a 432-amino acid protein

  • Confirmation of approximately 2 kb of 5'-untranslated sequence

This methodical approach established the first characterized fish alpha-2 adrenergic receptor, opening comparative studies across vertebrate lineages.

What expression systems are most effective for producing recombinant Labrus ossifagus alpha-2 adrenergic receptor?

For functional studies of the Labrus ossifagus alpha-2 adrenergic receptor, researchers have successfully employed COS-7 cells as an expression system. This mammalian cell line allows proper processing and membrane insertion of the receptor, enabling subsequent pharmacological characterization. The methodology involves:

  • Transfection of COS-7 cells with expression vectors containing the full coding sequence of the receptor

  • Culture of transfected cells under appropriate conditions (typically 37°C, 5% CO₂)

  • Harvesting of cells 48-72 hours post-transfection

  • Membrane preparation for binding assays or whole-cell assays for functional studies

How does the pharmacological profile of recombinant Labrus ossifagus alpha-2 adrenergic receptor compare to mammalian alpha-2 receptor subtypes?

Radioligand binding studies with [³H]-rauwolscine on COS-7 cells expressing the recombinant Labrus ossifagus alpha-2 receptor reveal a distinctive pharmacological profile. The binding displays high affinity and saturability with a KD of 0.8 ± 0.1 nM and a Bmax of 5.7 ± 1.0 pmol mg⁻¹ of protein .

Competition studies with various ligands established the following order of potency:

For agonists:

  • Medetomidine > Clonidine > p-Aminoclonidine > B-HT 920 > (-)-Noradrenaline

For antagonists:

  • Rauwolscine > Atipamezole > Yohimbine > Phentolamine > Prazosin

This profile differs somewhat from mammalian α2-adrenoceptor subtypes, particularly in the relative potencies of certain ligands. For example, the fish receptor shows higher sensitivity to medetomidine compared to typical mammalian α2A receptors. These differences likely reflect evolutionary adaptations to aquatic environments and divergent physiological roles of adrenergic signaling in teleost fish versus mammals .

What are the functional implications of the regulatory elements identified in the 5'-untranslated region of the Labrus ossifagus alpha-2 adrenergic receptor gene?

Analysis of the 5'-untranslated region (approximately 2 kb) of the Labrus ossifagus alpha-2 adrenergic receptor gene reveals several potential regulatory elements that suggest sophisticated transcriptional control mechanisms. These elements include:

  • Cyclic AMP-responsive elements (CRE)

  • Calcium-regulated transcription factor binding sites

  • Steroid hormone response elements

The presence of these regulatory sequences suggests that expression of the α2-F receptor may be dynamically regulated by:

  • Stress responses via cAMP signaling pathways

  • Calcium-dependent cellular processes

  • Hormonal status via steroid signaling

This complex regulatory architecture implies that the receptor's expression may be context-dependent and responsive to the physiological state of the fish, particularly in melanophores where receptor density may need to adjust rapidly to environmental conditions. The conservation of these regulatory elements compared to mammalian orthologues provides insights into the evolution of adrenergic signaling systems across vertebrates .

Researchers investigating the transcriptional regulation of this receptor should consider these elements when designing experiments to study its expression under various physiological or experimental conditions.

What methodological approaches are most effective for studying the functional role of the Labrus ossifagus alpha-2 adrenergic receptor in melanophore signaling?

To investigate the functional role of the Labrus ossifagus alpha-2 adrenergic receptor in melanophore signaling, researchers should employ a multi-faceted approach:

  • Isolated Melanophore Assays

    • Isolation of melanophores from Labrus ossifagus skin

    • Measurement of pigment aggregation/dispersion in response to receptor agonists/antagonists

    • Quantification via spectrophotometric or microscopic image analysis techniques

  • Heterologous Expression Systems

    • Expression of the receptor in mammalian cell lines (e.g., COS-7, HEK293)

    • Co-expression with downstream signaling components (G proteins, adenylyl cyclase)

    • Measurement of cAMP levels, Ca²⁺ mobilization, or ERK phosphorylation

  • CRISPR/Cas9-Mediated Receptor Modification

    • Generation of point mutations to study structure-function relationships

    • Domain swapping with mammalian receptors to identify regions responsible for fish-specific pharmacology

    • Creation of fluorescently tagged receptors to study trafficking and localization

  • Signaling Pathway Analysis

    • Use of specific inhibitors for G proteins (pertussis toxin), adenylyl cyclase, or PKA

    • Analysis of cross-talk with other signaling pathways relevant to melanophore function

    • Phosphoproteomic approaches to identify novel downstream targets

These methodological approaches should be integrated to provide a comprehensive understanding of how the Labrus ossifagus alpha-2 adrenergic receptor regulates melanophore function in response to environmental and neuroendocrine signals .

How can researchers overcome challenges in producing high-quality recombinant Labrus ossifagus alpha-2 adrenergic receptor for structural studies?

Producing high-quality recombinant Labrus ossifagus alpha-2 adrenergic receptor for structural studies presents several challenges due to its membrane protein nature. Effective strategies include:

  • Expression System Optimization

    • Use of insect cell expression systems (Sf9, Hi5) which often provide higher yields for GPCRs

    • Incorporation of thermostabilizing mutations to enhance protein stability

    • Addition of fusion partners (T4 lysozyme, BRIL) to improve crystallization properties

  • Construct Engineering

    • Truncation of flexible N- and C-terminal regions while preserving key functional domains

    • Introduction of disulfide bridges to stabilize specific conformations

    • Use of nanobodies or conformational antibodies to lock the receptor in specific states

  • Solubilization and Purification

    • Screening of detergents (DDM, LMNG, GDN) for optimal extraction

    • Use of lipid nanodiscs or SMALPs for maintaining a native-like lipid environment

    • Implementation of ligand-affinity chromatography for selective purification of correctly folded receptor

  • Quality Assessment Protocols

    • Size-exclusion chromatography to assess monodispersity

    • Ligand binding assays to confirm functionality post-purification

    • Circular dichroism to verify secondary structure integrity

When expressing the His-tagged full-length Labrus ossifagus alpha-2 adrenergic receptor in E. coli, researchers should consider using special strains designed for membrane protein expression (e.g., C41(DE3), C43(DE3)) and optimize induction conditions to balance expression yield with proper folding .

What insights does the comparative analysis of Labrus ossifagus alpha-2 adrenergic receptor provide regarding the evolution of adrenergic signaling systems?

Comparative analysis of the Labrus ossifagus alpha-2 adrenergic receptor provides valuable insights into the evolution of adrenergic signaling systems across vertebrate lineages:

  • Sequence Conservation and Divergence

    • The 47-57% sequence identity with human alpha-2 adrenergic receptors indicates conservation of core functional domains

    • The greatest sequence conservation occurs in the transmembrane domains and ligand-binding pocket

    • The most divergent regions are the third intracellular loop and C-terminal tail, suggesting species-specific regulation of G protein coupling and receptor desensitization

  • Pharmacological Adaptations

    • The distinct pharmacological profile of the fish receptor (e.g., higher affinity for medetomidine) suggests adaptation to specific ecological niches

    • These adaptations may reflect different selective pressures on adrenergic signaling in aquatic versus terrestrial environments

  • Physiological Role Specialization

    • In fish, alpha-2 adrenergic receptors play a prominent role in melanophore function, a specialized adaptation for camouflage and social signaling

    • This contrasts with mammals where these receptors are more prominently involved in neurotransmitter release regulation and vascular tone

  • Regulatory Evolution

    • The presence of specific regulatory elements in the 5'-untranslated region suggests evolution of distinct transcriptional control mechanisms

    • These differences may reflect adaptation to different environmental stressors and physiological demands

This evolutionary perspective provides context for understanding how the molecular properties of adrenergic receptors have been shaped by natural selection across vertebrate lineages, from fish to mammals .

What are the optimal conditions for expressing and purifying recombinant Labrus ossifagus alpha-2 adrenergic receptor?

For successful expression and purification of recombinant Labrus ossifagus alpha-2 adrenergic receptor, researchers should consider the following optimized protocol:

Expression System Selection:

  • E. coli is suitable for basic studies and can produce the His-tagged full-length protein (432 amino acids)

  • Mammalian expression systems (HEK293, COS-7) are preferable for functional studies requiring proper folding and post-translational modifications

Expression Conditions:

  • For E. coli: Culture at lower temperatures (16-18°C) after induction to improve folding

  • For mammalian cells: Transfect using lipid-based reagents and harvest 48-72 hours post-transfection

Purification Strategy:

  • Cell lysis under conditions that preserve membrane integrity

  • Membrane fraction isolation via differential centrifugation

  • Solubilization using mild detergents (DDM, LMNG) with cholesterol supplementation

  • Affinity purification using Ni-NTA for His-tagged protein

  • Size exclusion chromatography for final polishing

Quality Control:

  • Western blotting to confirm target protein expression

  • Ligand binding assays (using [³H]-rauwolscine) to verify functionality

  • SEC-MALS to assess monodispersity and oligomeric state

These methodological considerations are critical for obtaining properly folded, functional receptor suitable for biochemical, pharmacological, and potentially structural studies .

How can researchers effectively design experiments to study the regulation of Labrus ossifagus alpha-2 adrenergic receptor transcription?

Based on the identified regulatory elements in the 5'-untranslated region of the Labrus ossifagus alpha-2 adrenergic receptor gene, researchers can design comprehensive experiments to study transcriptional regulation using the following approaches:

  • Reporter Gene Assays

    • Clone the 5'-untranslated region (~2kb) upstream of a luciferase reporter gene

    • Create truncated or mutated versions to identify specific functional elements

    • Transfect into relevant cell lines and measure reporter activity under various conditions:

      • Treatment with cAMP analogs or adenylyl cyclase activators

      • Calcium ionophores or calcium-mobilizing agents

      • Relevant steroid hormones (cortisol, sex steroids)

  • Chromatin Immunoprecipitation (ChIP)

    • Identify transcription factors binding to regulatory elements in vivo

    • Use antibodies against CREB, calcium-responsive transcription factors, or steroid receptors

    • Perform in native tissues (fish skin) or in heterologous expression systems

  • EMSA (Electrophoretic Mobility Shift Assays)

    • Synthesize oligonucleotides containing putative binding sites

    • Incubate with nuclear extracts from fish tissues or relevant cell lines

    • Perform competition and supershift assays to identify specific binding proteins

  • Tissue-Specific Expression Analysis

    • Isolate RNA from various tissues of Labrus ossifagus

    • Perform quantitative RT-PCR to measure receptor expression levels

    • Correlate with physiological states or environmental conditions

These experimental approaches will provide insights into the dynamic regulation of receptor expression in response to environmental and physiological cues, enhancing our understanding of adrenergic signaling in teleost fish .

What experimental design is recommended for comparative pharmacological profiling of Labrus ossifagus alpha-2 adrenergic receptor against mammalian subtypes?

To conduct rigorous comparative pharmacological profiling of the Labrus ossifagus alpha-2 adrenergic receptor against mammalian subtypes, researchers should implement the following experimental design:

  • Parallel Expression Systems

    • Express the fish receptor and human α2A, α2B, and α2C subtypes in the same cell background (e.g., COS-7 or HEK293)

    • Ensure comparable expression levels through quantitative western blotting or radioligand binding assays

    • Create chimeric receptors exchanging domains between fish and mammalian receptors to identify regions responsible for pharmacological differences

  • Comprehensive Ligand Panel Testing

    • Perform saturation binding assays with [³H]-rauwolscine to determine Kd and Bmax values

    • Conduct competition binding experiments with a diverse panel of ligands including:

      • Endogenous agonists (norepinephrine, epinephrine)

      • Synthetic agonists (medetomidine, clonidine, p-aminoclonidine, B-HT 920)

      • Antagonists (rauwolscine, atipamezole, yohimbine, phentolamine, prazosin)

    • Generate complete dose-response curves to determine Ki values

  • Functional Assays

    • Measure inhibition of forskolin-stimulated cAMP production

    • Assess G protein activation using [³⁵S]GTPγS binding assays

    • Monitor calcium mobilization and ERK phosphorylation as downstream readouts

    • Determine biased signaling properties between G protein and β-arrestin pathways

  • Data Analysis

    • Calculate affinity (pKi) and potency (pEC₅₀) values for all ligands

    • Generate radar plots to visualize pharmacological fingerprints

    • Perform hierarchical clustering to determine relationships between receptor subtypes

This systematic approach will reveal both quantitative and qualitative differences in ligand recognition and signaling properties between the fish and mammalian receptors, providing insights into both evolutionary conservation and species-specific adaptations .

How can the Labrus ossifagus alpha-2 adrenergic receptor be utilized as a tool for developing novel ligands with potential therapeutic applications?

The unique pharmacological profile of the Labrus ossifagus alpha-2 adrenergic receptor offers opportunities for developing novel therapeutic agents with potentially different selectivity profiles from those targeting mammalian receptors:

  • Comparative Screening Platform

    • Establish stable cell lines expressing the fish receptor alongside human subtypes

    • Develop high-throughput screening assays using fluorescence-based detection methods

    • Screen compound libraries to identify molecules with differential selectivity profiles

    • Focus on compounds that show selective binding to specific receptor subtypes

  • Structure-Activity Relationship Studies

    • Identify key amino acid differences in the ligand-binding pocket between fish and mammalian receptors

    • Design modified ligands that exploit these differences

    • Synthesize compound series with systematic structural variations

    • Characterize binding affinities and functional responses

  • Discovery of Novel Pharmacological Properties

    • The competition binding data showing that medetomidine has particularly high affinity for the fish receptor can guide development of derivatives with enhanced subtype selectivity

    • The order of potency differences between fish and mammalian receptors provides insights into structural features that might be exploited for developing selective compounds

  • Application Areas

    • Development of subtype-selective agonists for pain management with reduced side effects

    • Creation of novel sedatives with improved hemodynamic profiles

    • Design of agents for attention deficit disorders with optimized therapeutic windows

The comparative study of fish and mammalian alpha-2 adrenergic receptors thus provides a valuable platform for ligand discovery that may lead to improved therapeutic agents for various clinical applications .

What are the key considerations in developing antibodies specific to Labrus ossifagus alpha-2 adrenergic receptor for research applications?

Developing antibodies specific to the Labrus ossifagus alpha-2 adrenergic receptor requires careful consideration of several factors to ensure specificity, sensitivity, and utility in research applications:

  • Antigen Selection and Design

    • Analyze the receptor sequence to identify regions with low homology to other G protein-coupled receptors

    • Focus on extracellular domains for antibodies intended for cell surface detection

    • Consider using multiple antigens targeting different epitopes:

      • Synthetic peptides corresponding to extracellular loops

      • Recombinant protein fragments of N-terminal domains

      • Full-length purified receptor in native conformation for conformational antibodies

  • Production Strategy

    • For polyclonal antibodies: Immunize rabbits or other suitable species with purified receptor or synthetic peptides

    • For monoclonal antibodies: Consider recombinant antibody production systems similar to those used for mammalian alpha-2A adrenergic receptor antibodies

    • For nanobodies: Immunize camelids and select single-domain antibodies with high specificity

  • Validation Protocols

    • Western blotting against recombinant receptor and native tissue extracts

    • Immunocytochemistry on cells expressing the receptor vs. control cells

    • Flow cytometry to confirm cell surface binding

    • Immunoprecipitation to verify interaction with the native protein

    • Cross-reactivity testing against human alpha-2 receptor subtypes to confirm specificity

  • Application Optimization

    • Determine optimal antibody concentrations for each application

    • Establish appropriate blocking conditions to minimize background

    • Verify antibody performance across different fixation and sample preparation methods

Following these considerations will yield high-quality antibodies suitable for studying expression, localization, and regulation of the Labrus ossifagus alpha-2 adrenergic receptor in various experimental contexts .

What emerging technologies could advance our understanding of Labrus ossifagus alpha-2 adrenergic receptor structure-function relationships?

Several cutting-edge technologies offer promising avenues for deeper investigation of the Labrus ossifagus alpha-2 adrenergic receptor structure-function relationships:

  • Cryo-Electron Microscopy

    • Determination of high-resolution structures in various activation states

    • Visualization of receptor-G protein complexes

    • Comparison with mammalian receptor structures to identify conserved and divergent features

    • Requirements: Development of stabilized receptor constructs and optimization of sample preparation protocols

  • Single-Molecule FRET Imaging

    • Real-time monitoring of receptor conformational changes

    • Investigation of dynamics between active and inactive states

    • Analysis of the effects of different ligands on receptor conformational landscape

    • Applications: Fluorescently labeled receptors with donor-acceptor pairs at strategic positions

  • AI-Assisted Structural Modeling

    • Implementation of AlphaFold2 or similar AI tools to predict receptor structures

    • Molecular dynamics simulations to study receptor dynamics in membranes

    • In silico docking studies to identify novel ligands

    • Virtual screening for compounds with specific selectivity profiles

  • CRISPR-Based Genomic Engineering

    • Creation of knock-in fish models with fluorescently tagged receptors

    • Generation of specific point mutations to test structure-function hypotheses

    • Development of conditional expression systems to study receptor function in specific tissues

    • Challenges: Adaptation of CRISPR technologies for efficient use in Labrus ossifagus

  • Proteomics and Interactomics

    • Identification of the complete interactome of the receptor in native tissues

    • Characterization of post-translational modifications and their functional significance

    • Comparative analysis with mammalian receptor interactomes

    • Methods: BioID or APEX2 proximity labeling coupled with mass spectrometry

These technologies, when applied in combination, would provide unprecedented insights into how the structural features of this evolutionary distinct receptor contribute to its unique pharmacological and signaling properties .

How might comparative studies of the Labrus ossifagus alpha-2 adrenergic receptor inform our understanding of G protein-coupled receptor evolution across vertebrate lineages?

Comparative studies of the Labrus ossifagus alpha-2 adrenergic receptor offer unique opportunities to enhance our understanding of G protein-coupled receptor evolution across vertebrate lineages:

  • Phylogenetic Analysis and Molecular Clock Studies

    • Construction of comprehensive phylogenetic trees including fish, amphibian, reptilian, avian, and mammalian alpha-2 receptors

    • Estimation of evolutionary rates in different receptor domains

    • Identification of positively selected amino acid positions that might reflect adaptation to different ecological niches

    • Correlation with major evolutionary transitions in vertebrate history

  • Comparative Genomics Approaches

    • Analysis of synteny and gene neighborhood across species

    • Investigation of regulatory element conservation and divergence

    • Examination of evolution of alternative splicing patterns

    • Assessment of copy number variation across teleost lineages (considering the teleost-specific genome duplication)

  • Structure-Function Evolutionary Conservation

    • Mapping of conserved vs. variable residues onto structural models

    • Identification of species-specific differences in ligand binding pockets

    • Analysis of co-evolution between receptors and their cognate G proteins

    • Examination of evolutionary constraints on signaling pathways

  • Adaptive Significance Investigation

    • Correlation of receptor properties with species-specific physiological adaptations

    • Examination of receptor evolution in species from different ecological niches

    • Investigation of convergent evolution in distantly related lineages

    • Analysis of how receptor pharmacology correlates with environmental factors

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.