Recombinant Laccaria bicolor Altered inheritance of mitochondria protein 31, mitochondrial (AIM31)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to meet your requirements.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag is required, please inform us, and we will prioritize its inclusion.
Synonyms
RCF1; AIM31; LACBIDRAFT_293603; Respiratory supercomplex factor 1, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-187
Protein Length
full length protein
Species
Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) (Bicoloured deceiver) (Laccaria laccata var. bicolor)
Target Names
RCF1
Target Protein Sequence
MASNTIAQSPSGAIHVPIDQGYEGWTEKFSRKFKENPWVPIGCVATCGALIMSAVKMRAG KSTDMNYWLRARVVIQGVTIAALVAGSMSLQAQRKKVEEATGVTEETKKEREKEEFESRL RGAQAAYEEEAALAGKTVKGPTVKRHVHPETGAQEREEETVERKAATLAGRQHPHPVAPV DKKPQEG
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit involved in the assembly of respiratory supercomplexes.
Database Links
Protein Families
RCF1 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is AIM31 and what are its alternative nomenclatures?

AIM31 (Altered inheritance of mitochondria protein 31, mitochondrial) from Laccaria bicolor is also known as Respiratory supercomplex factor 1, mitochondrial (RCF1). The gene is sometimes referred to by its ORF name LACBIDRAFT_293603. This protein is cataloged in the UniProt database with the identifier B0D4J7 . Understanding the various nomenclatures is essential when conducting literature searches or cross-referencing between different research databases to ensure comprehensive data collection.

What is the biological context of Laccaria bicolor and why is it significant for AIM31 research?

Laccaria bicolor is an ectomycorrhizal fungus that forms symbiotic associations with tree roots in boreal, temperate, and montane forest ecosystems. This symbiotic relationship involves nutrient exchange, where the fungus captures soil minerals (P, N, water) and organic nitrogen, then translocates them to the host plant's roots. In return, the fungus receives carbon from the plant's photosynthesis (approximately 10-20% of host photoassimilates) . As the first symbiotic fungal genome to be sequenced, L. bicolor provides critical insights into plant-fungal interactions, making it an important model organism. AIM31's role in mitochondrial function is particularly significant in this context, as energy metabolism is crucial for supporting the symbiotic relationship.

What are the optimal storage and handling conditions for recombinant AIM31 protein?

Based on manufacturer protocols, recombinant AIM31 protein should be stored at -20°C/-80°C for long-term preservation. For working solutions, store aliquots at 4°C for a maximum of one week . Repeated freeze-thaw cycles significantly reduce protein stability and activity, so single-use aliquots are strongly recommended. The typical storage buffer consists of a Tris/PBS-based buffer with 6% Trehalose at pH 8.0, which maintains protein stability . Some preparations may include 50% glycerol as a cryoprotectant . Always centrifuge the vial briefly before opening to ensure all material is at the bottom.

What reconstitution protocol is recommended for lyophilized AIM31 protein?

For optimal reconstitution of lyophilized AIM31 protein:

  • Centrifuge the vial prior to opening to collect all material at the bottom

  • Reconstitute using deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is commonly recommended)

  • Prepare single-use aliquots to avoid repeated freeze-thaw cycles

  • Store reconstituted aliquots at -20°C/-80°C for extended storage

This protocol ensures maximum retention of protein structure and function while minimizing degradation during experimental use.

How can the purity and integrity of recombinant AIM31 be assessed?

Recombinant AIM31 protein purity should be verified using SDS-PAGE, with commercial preparations typically showing >85% purity (CUSABIO) or >90% purity (Creative BioMart) . For functional integrity assessment, consider these additional methods:

MethodApplicationExpected Result
Western BlotProtein identity confirmationSingle band at ~21 kDa
Mass SpectrometryMolecular weight verificationPeak at 21,345 Da (exact mass varies with tags)
Circular DichroismSecondary structure assessmentPattern consistent with alpha-helical content
Activity AssaysFunctional verificationAssociation with mitochondrial membrane fractions

When working with His-tagged versions, additional verification using anti-His antibodies can confirm successful protein production and purification .

What is the proposed function of AIM31 in mitochondrial processes?

As indicated by its alternative name (Respiratory supercomplex factor 1, mitochondrial), AIM31/RCF1 likely plays a crucial role in the organization and stability of respiratory chain supercomplexes in mitochondria . Research suggests it functions as a membrane protein involved in the assembly or maintenance of these complexes. The protein contains regions consistent with membrane association ("VTIAALVAGSMSLQAQR"), supporting its predicted mitochondrial membrane localization . Its role in "altered inheritance of mitochondria" suggests involvement in mitochondrial dynamics, potentially influencing mitochondrial transmission during cell division or fusion/fission events in the fungal lifecycle.

How does AIM31 compare between Laccaria bicolor and other fungal species?

While the search results don't provide direct comparative data, AIM31/RCF1 is likely part of a conserved family of proteins involved in mitochondrial function across fungal species. Given that L. bicolor is an ectomycorrhizal fungus with a sequenced genome (65 million base pairs), comparative genomic analysis with saprobic and pathogenic fungi would reveal conservation patterns of AIM31 . Researchers should perform multiple sequence alignment analyses to identify:

  • Conserved domains across fungal lineages

  • Signature sequences specific to ectomycorrhizal fungi

  • Potential adaptation signatures related to symbiotic lifestyle

This comparative approach would enhance understanding of how mitochondrial proteins like AIM31 may have evolved in relation to different fungal ecological strategies.

What experimental approaches are most effective for studying AIM31 localization and interactions?

Based on its predicted function, the following experimental approaches would be most effective for characterizing AIM31:

ApproachMethodologyExpected Outcome
Subcellular LocalizationFluorescent protein tagging, immunogold EMConfirmation of mitochondrial membrane localization
Protein-Protein InteractionsCo-immunoprecipitation, Yeast two-hybrid, BioIDIdentification of interaction partners in respiratory complexes
Loss-of-Function AnalysisCRISPR-Cas9 knockout, RNAiAssessment of impact on mitochondrial morphology and function
Supercomplex AnalysisBlue native PAGE, Cryo-EMDetermination of AIM31's position within respiratory supercomplexes

When designing these experiments, researchers should consider that tags may interfere with the protein's function, particularly given its membrane association and potential incorporation into larger complexes.

How might AIM31 function relate to the symbiotic lifestyle of Laccaria bicolor?

Laccaria bicolor forms ectomycorrhizal associations with tree roots, creating a metabolically demanding symbiotic relationship that requires efficient energy production . AIM31's function in respiratory chain organization may be particularly important for optimizing ATP production during different phases of the symbiotic lifecycle. Researchers should investigate:

  • Expression patterns of AIM31 during different stages of mycorrhizal formation

  • Comparative mitochondrial efficiency between free-living and symbiotic states

  • Potential adaptations in AIM31 structure/function that support the high metabolic demands of nutrient exchange

The symbiotic interface, where the fungus contacts tree roots, likely requires specialized energy metabolism to support nutrient transport, making AIM31's role in mitochondrial function potentially crucial for symbiotic success.

What methods can be used to assess the impact of AIM31 mutations on mitochondrial function?

To assess how mutations in AIM31 affect mitochondrial function, researchers should implement a multi-parameter approach:

Analysis TypeMethodologyParameters Measured
Respiration AnalysisHigh-resolution respirometryOxygen consumption rates, respiratory control ratios
Mitochondrial Membrane PotentialTMRM or JC-1 fluorescenceMembrane potential strength, heterogeneity
Supercomplex AssemblyBlue native PAGE, Cryo-EMAltered supercomplex formation patterns
ROS ProductionMitoSOX, DCF-DA fluorescenceChanges in mitochondrial ROS generation
ATP ProductionLuciferase-based assaysQuantitative ATP output
Mitochondrial DynamicsLive-cell imagingFusion/fission rates, mitochondrial morphology

This comprehensive approach would provide insights into how AIM31 contributes to mitochondrial function in Laccaria bicolor and potentially reveal novel aspects of mitochondrial adaptation in symbiotic fungi.

How can isotope labeling experiments reveal AIM31's role in metabolic processes?

Isotope labeling experiments could illuminate AIM31's role in mitochondrial metabolism and symbiotic nutrient exchange:

  • Use 13C-labeled carbon sources to track metabolic flux through the TCA cycle in wild-type versus AIM31-mutant strains

  • Apply 15N-labeled nitrogen sources to examine differences in nitrogen assimilation and transfer capabilities

  • Implement pulse-chase experiments with isotope-labeled substrates to determine if AIM31 influences metabolite transport rates

These approaches would help determine whether AIM31's impact extends beyond structural roles in respiratory complexes to influence metabolic regulation relevant to the fungus's symbiotic lifestyle.

What are common issues when working with recombinant AIM31 and how can they be addressed?

When working with recombinant AIM31, researchers commonly encounter these challenges:

IssuePossible CauseSolution
Low Protein SolubilityHydrophobic regionsAdd mild detergents (0.1% Triton X-100) to maintain solubility
Aggregation After ThawingImproper storage/thawingAlways thaw on ice; consider adding stabilizing agents like BSA (0.1%)
Loss of Activity Over TimeOxidation of critical residuesAdd reducing agents (e.g., 1mM DTT) to storage buffer
Inconsistent Performance in AssaysBatch-to-batch variationUse single lot for complete experimental series; include positive controls
Protein DegradationProtease contaminationAdd protease inhibitors to working solutions

Additionally, researchers must consider that the His-tagged form (available commercially) may exhibit different properties than the native protein, particularly in binding studies or structural analyses .

How should researchers interpret experimental results when comparing different preparations of recombinant AIM31?

When comparing different recombinant AIM31 preparations, researchers should consider several factors that may influence experimental outcomes:

  • Expression System Differences: E. coli-expressed protein (as offered by suppliers) may lack post-translational modifications present in native fungal AIM31

  • Tag Interference: His-tags or other fusion elements may alter protein behavior

  • Purity Variations: Preparations range from >85% to >90% purity depending on manufacturer

  • Buffer Composition: Different storage buffers (Tris-based with varying additives) may affect protein stability and activity

To address these variables, implement standardized experimental controls:

  • Include activity standards across different protein batches

  • Normalize data to protein concentration determined by multiple methods

  • Consider tag cleavage experiments to assess tag effects

  • Document and report all buffer components and preparation methods

How does AIM31 research contribute to broader understanding of fungal symbiotic relationships?

Understanding AIM31's role in mitochondrial function provides insights into the metabolic adaptations that enable Laccaria bicolor's symbiotic lifestyle. The sequencing of L. bicolor as the first symbiotic fungal genome highlighted the importance of examining the molecular basis of plant-fungal interactions . Future research directions should explore:

  • Comparative analysis of AIM31 expression and function across symbiotic versus non-symbiotic fungi

  • Investigation of how AIM31-mediated mitochondrial function supports the energy demands of nutrient exchange

  • Examination of potential signaling roles for mitochondria in establishing and maintaining symbiosis

  • Analysis of how environmental stressors affect AIM31 function and symbiotic stability

These approaches would contribute to our understanding of the molecular mechanisms underpinning ecologically important mutualisms.

What emerging technologies could advance AIM31 functional characterization?

Several cutting-edge technologies hold promise for deeper characterization of AIM31:

TechnologyApplication to AIM31 ResearchPotential Insights
Cryo-Electron Tomography3D visualization of AIM31 in intact mitochondriaNative organization within membrane context
Proximity Labeling ProteomicsIdentification of transient interaction partnersComplete interaction network in vivo
Single-Cell MetabolomicsMetabolic profiling in symbiotic interfacesMicroenvironmental metabolic signatures
Organelle-Specific CRISPRTargeted mitochondrial genome editingDirect assessment of interactions with mitochondrial DNA
In situ Structural BiologyStructure determination in native environmentConformational dynamics during function

These approaches would overcome limitations of traditional biochemical methods, particularly for membrane-associated proteins like AIM31, providing unprecedented resolution of its function.

How can computational approaches enhance our understanding of AIM31 structure-function relationships?

Computational methods offer powerful tools for AIM31 research when experimental approaches face limitations:

  • Homology Modeling and Molecular Dynamics: Predict AIM31 structure based on related proteins and simulate its behavior in membranes

  • Evolutionary Analysis: Trace the evolution of AIM31/RCF1 across fungal lineages to identify conserved functional domains

  • Systems Biology Integration: Model how AIM31 function impacts broader mitochondrial and cellular processes

  • Machine Learning Approaches: Predict potential post-translational modifications and regulatory mechanisms

  • Network Analysis: Identify potential regulatory relationships between AIM31 and other mitochondrial proteins

These computational approaches can generate testable hypotheses about AIM31 function that guide experimental design and interpretation, particularly regarding its membrane organization and interaction partners.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.