Recombinant Laccaria bicolor Golgi apparatus membrane protein TVP23 (TVP23)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Laccaria bicolor Golgi Apparatus Membrane Protein TVP23 (TVP23)

TVP23 is a transmembrane protein localized to the Golgi apparatus in the ectomycorrhizal fungus Laccaria bicolor. Its recombinant form has been produced for research purposes, with applications in structural studies and functional assays. The protein is characterized by its full-length sequence (1–266 amino acids) and an N-terminal His-tag for purification .

Current Research Context

While TVP23’s exact role in L. bicolor remains understudied, its homologs in other organisms (e.g., human TVP23B) are linked to:

  • Golgi function: Regulation of glycosylation enzymes and membrane trafficking .

  • Host-microbe interactions: Maintenance of intestinal mucus barriers in mammals .

Experimental Tools

Recombinant TVP23 is used in:

  • ELISA assays for antibody or binding partner detection .

  • Structural studies to probe Golgi membrane dynamics in symbiotic fungi.

Table 1: Recombinant TVP23 Production Parameters

ParameterValueSource
Expression HostE. coli
Tag EfficiencyN-terminal His-tag for affinity chromatography
YieldNot explicitly stated; available in 50 µg quantities
StabilityAvoid repeated freeze-thaw cycles; store at -20°C/-80°C

Table 2: Genomic Context of TVP23 in L. bicolor

FeatureDetailSource
Genome Size~60 Mb
TE Content24% of genome (Copia-like elements dominate)
Gene FamiliesMultigene families for symbiosis-related proteins

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
TVP23; LACBIDRAFT_300834; Golgi apparatus membrane protein TVP23
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-266
Protein Length
full length protein
Species
Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) (Bicoloured deceiver) (Laccaria laccata var. bicolor)
Target Names
TVP23
Target Protein Sequence
MAELKKGHRVFSGQLIAVFAVVESSYTLHTTMSVAQPLLDTIEPDEPLESSVNTKGPATA PVVLTPTHATQNDPESGIVGIFRQSAHPTALFFLYLFRIAAIAVYILCGWFTDNYVLSTV AVVVLLAMDFWNCRNVSGRTLVGLRFWNQVDEDGESYWVFESRDPSRPANPIDSKMFWIA LYVFPLLWSVLLIVSLLKLGFAFIPIVVLALVFNITNVIGFTYADRDAKQKWATSVAGSA WGMGLGGIGGQILTGAVKKGVGRVFG
Uniprot No.

Target Background

Function
Golgi membrane protein involved in vesicular trafficking.
Database Links
Protein Families
TVP23 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the current understanding of TVP23's role in fungal-plant symbiotic relationships?

TVP23 is implicated in the molecular mechanisms that facilitate mutualistic associations between L. bicolor and host plants. Current research indicates it may be involved in the production and/or trafficking of signaling molecules that mediate host recognition and symbiotic development. Specifically, L. bicolor produces lipochitooligosaccharides (LCOs) that trigger calcium spiking in host plants like Populus in a CASTOR/POLLUX-dependent manner . As a Golgi membrane protein, TVP23 may participate in the biosynthesis or secretion pathway of these symbiotic signals, although direct evidence linking TVP23 to LCO production requires further investigation.

Research has demonstrated that these fungal-derived LCOs can:

  • Trigger root hair branching in legumes

  • Induce calcium spiking in Populus

  • Enhance lateral root development (non-sulfated LCOs)

  • Improve mycorrhizal colonization (sulfated LCOs)

What expression systems are recommended for producing recombinant L. bicolor TVP23?

Based on current protocols, E. coli is the established expression system for producing recombinant L. bicolor TVP23 . The recommended approach includes:

  • Cloning the full-length (1-266aa) TVP23 gene with an N-terminal His-tag

  • Expressing in E. coli under appropriate induction conditions

  • Purifying using affinity chromatography

  • Validating protein identity and purity via SDS-PAGE (>90% purity standard)

The resulting recombinant protein maintains structural features necessary for experimental applications while providing the advantage of affinity purification via the His-tag .

What are the optimal conditions for storing and handling recombinant TVP23?

For optimal stability and activity of recombinant TVP23, researchers should follow these research-validated protocols:

Storage ConditionRecommendationNotes
Long-term storage-20°C/-80°CAliquoting necessary to avoid freeze-thaw cycles
Buffer compositionTris/PBS-based buffer, pH 8.0 with 6% TrehaloseMaintains protein stability
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mLBrief centrifugation prior to opening recommended
Working solutionAdd 5-50% glycerol (final concentration)50% is the default recommendation
Working aliquotsStore at 4°CUse within one week

Repeated freeze-thaw cycles should be avoided as they significantly reduce protein stability and activity .

How can researchers effectively investigate TVP23's role in symbiotic signaling pathways?

A comprehensive experimental approach to investigate TVP23's role in symbiotic signaling should incorporate:

  • Gene expression analysis: Quantifying TVP23 expression during different stages of mycorrhizal colonization

  • Cellular localization studies: Using fluorescent protein fusions or immunolocalization to confirm Golgi localization and potential redistribution during symbiotic events

  • Functional knockout/knockdown experiments:

    • RNA interference (RNAi) targeting TVP23

    • CRISPR-Cas9 gene editing to create null mutants

    • Comparison with CASTOR/POLLUX and CCaMK knockdowns that have been shown to affect symbiotic signaling

  • Calcium spiking assays: Utilizing calcium reporters (like G-GECO) to monitor calcium oscillations in response to fungal signals, similar to experiments that demonstrated L. bicolor hyphae trigger calcium spiking in Populus

  • Protein-protein interaction studies: Co-immunoprecipitation or yeast two-hybrid assays to identify potential interaction partners in the Common Symbiosis Pathway

This multifaceted approach allows for a comprehensive understanding of TVP23's contribution to symbiotic processes.

How does TVP23 potentially contribute to lipochitooligosaccharide production in L. bicolor?

While direct evidence linking TVP23 to LCO biosynthesis is still emerging, as a Golgi membrane protein, TVP23 likely contributes to LCO production through one or more of the following mechanisms:

  • Vesicular trafficking: Facilitating transport of LCO precursors or biosynthetic enzymes within the Golgi network

  • Glycosylation and modification: Participating in the processing of carbohydrate components of LCOs, particularly in the diverse array of both sulfated and non-sulfated LCOs produced by L. bicolor

  • Secretory pathway regulation: Controlling the release of mature LCOs into the extracellular environment

To investigate these potential functions, researchers should consider:

  • Comparative proteomics of wild-type vs. TVP23-depleted L. bicolor to identify alterations in the Golgi proteome

  • Metabolomic profiling to quantify changes in LCO production

  • Live-cell imaging to track vesicular trafficking in the presence and absence of functional TVP23

What is the relationship between TVP23 and Common Symbiosis Pathway components?

The Common Symbiosis Pathway (CSP) plays a crucial role in facilitating plant-fungal symbiotic associations. Research has demonstrated that L. bicolor utilizes this pathway for establishing mutualistic relationships with host plants like Populus . The relationship between TVP23 and CSP components involves several key aspects:

  • Signal production: TVP23 may participate in producing or processing fungal signals (LCOs) that activate the CSP in host plants

  • Downstream effects: Experimental evidence shows that:

    • L. bicolor-produced LCOs trigger calcium spiking in Populus in a CASTOR/POLLUX-dependent manner

    • Non-sulfated LCOs enhance lateral root development in a CCaMK-dependent manner

    • Sulfated LCOs enhance L. bicolor colonization of Populus

  • Experimental validation: Calcium spiking assays show that:

    • L. bicolor hyphae trigger calcium spiking comparable to that induced by the AM fungus Rhizophagus irregularis

    • This calcium spiking is dependent on CASTOR and/or POLLUX components of the CSP

    • Colonization of Populus by L. bicolor is reduced in CASTOR/POLLUX and CCaMK RNA interference lines

To further elucidate this relationship, researchers should consider dual-organism transcriptomics during symbiotic establishment, focusing on coordinated expression changes between fungal TVP23 and plant CSP components.

What methodologies can be employed to investigate the functional domains of TVP23?

Advanced structure-function analysis of TVP23 requires a combination of computational prediction and experimental validation:

  • Computational domain prediction:

    • Transmembrane domain prediction using algorithms like TMHMM or Phobius

    • Functional motif identification using InterProScan

    • Homology modeling based on related proteins with known structures

  • Site-directed mutagenesis:

    • Systematic mutation of predicted functional residues

    • Creation of chimeric proteins with domains from other TVP23 homologs

    • Truncation variants to identify minimal functional units

  • Functional complementation assays:

    • Expressing mutated variants in TVP23-knockout backgrounds

    • Quantifying restoration of symbiotic function through:

      • Mycorrhization rates

      • LCO production profiling

      • Calcium spiking induction capacity

  • Protein-protein interaction mapping:

    • Domain-specific yeast two-hybrid screens

    • Bimolecular fluorescence complementation to visualize interactions in vivo

    • Crosslinking mass spectrometry to identify interaction interfaces

This comprehensive approach allows researchers to define the specific regions of TVP23 responsible for its functions in symbiotic relationships.

What are common technical challenges when working with recombinant TVP23 and how can they be addressed?

Researchers working with recombinant TVP23 frequently encounter several technical challenges:

ChallengePotential Solution
Low expression yieldOptimize codon usage for E. coli; test different expression strains; reduce expression temperature to 16-20°C
Protein aggregationInclude mild detergents (0.1% Triton X-100 or 1% CHAPS) in the lysis buffer; purify under native conditions
Loss of activity after purificationInclude stabilizing agents such as glycerol (5-50%) and trehalose (6%) in storage buffer
Difficulty detecting protein-protein interactionsUse chemical crosslinking prior to co-immunoprecipitation; apply proximity labeling approaches
Limited in vivo functional assaysDevelop heterologous expression systems in model fungi with similar signaling pathways

For optimal reconstitution results, the recombinant protein should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL, and glycerol should be added to a final concentration of 5-50% for long-term storage stability .

How can researchers detect and quantify TVP23-dependent effects on symbiotic signaling?

To effectively detect and quantify TVP23-dependent effects on symbiotic signaling, researchers should employ the following methodological approaches:

  • Calcium spiking assays:

    • Use calcium reporter systems like G-GECO to visualize and quantify calcium oscillations

    • Compare spiking patterns between wild-type and TVP23-altered fungal strains

    • Measure key parameters including:

      • Percentage of spiking nuclei

      • Frequency of calcium spikes

      • Amplitude of calcium spikes

  • Root development phenotyping:

    • Assess lateral root development in response to TVP23-dependent signals

    • Measure primary root length and lateral root density

    • Compare responses in wild-type versus CSP-component knockdown plant lines

  • Colonization efficiency measurements:

    • Quantify the rate and extent of mycorrhizal colonization

    • Use microscopy techniques to assess fungal structure development

    • Compare colonization success between treatments with:

      • Wild-type fungi versus TVP23-altered strains

      • Addition of purified LCOs versus control treatments

  • Molecular markers of symbiotic responses:

    • Monitor expression of symbiosis-specific plant genes

    • Quantify fungal biomass using species-specific markers

    • Measure accumulation of symbiosis-related metabolites

These techniques provide comprehensive insights into the specific contributions of TVP23 to symbiotic signaling processes.

What are promising research avenues for understanding TVP23's evolutionary conservation across fungal species?

Understanding the evolutionary conservation of TVP23 provides valuable insights into its fundamental roles in fungal biology. Promising research approaches include:

  • Comparative genomics:

    • Identify and align TVP23 homologs across diverse fungal lineages

    • Quantify selection pressures on different protein domains

    • Correlate conservation patterns with symbiotic capability across species

  • Functional complementation studies:

    • Express TVP23 homologs from non-symbiotic fungi in L. bicolor

    • Test whether these proteins can restore symbiotic functions in TVP23-deficient mutants

    • Identify specific amino acid changes that correlate with symbiotic function

  • Ancestral sequence reconstruction:

    • Computationally predict ancestral TVP23 sequences

    • Express and characterize these reconstructed proteins

    • Track the acquisition of symbiosis-specific functions during evolution

  • Domain-swapping experiments:

    • Create chimeric proteins with domains from TVP23 homologs across fungal lineages

    • Test functionality in symbiotic signaling assays

    • Identify critical regions that enable symbiotic function

These approaches will provide insights into how TVP23 may have been co-opted or adapted for symbiotic function during the evolution of mycorrhizal associations.

How might TVP23 function integrate with other cellular pathways during symbiotic establishment?

TVP23's function likely intersects with multiple cellular pathways during symbiotic establishment. Investigating these interactions requires:

  • Systems biology approaches:

    • Multi-omics integration (transcriptomics, proteomics, metabolomics)

    • Network analysis to identify functional modules

    • Temporal profiling during symbiotic development

  • Secretory pathway analysis:

    • Comparative secretome analysis in the presence/absence of functional TVP23

    • Vesicle trafficking studies using fluorescent markers

    • Golgi morphology and function assessment during symbiotic interaction

  • Signaling crosstalk investigation:

    • Map interactions between TVP23-dependent processes and:

      • Nutrient sensing pathways

      • Cell wall remodeling mechanisms

      • Stress response systems

  • In situ visualization techniques:

    • Super-resolution microscopy to track TVP23 localization during symbiosis

    • Correlative light and electron microscopy to link protein distribution with ultrastructural changes

    • Live-cell imaging to monitor dynamic processes during host interaction

Understanding these integrated functions will provide a comprehensive view of how TVP23 contributes to the complex process of symbiotic establishment.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.