Recombinant Laccaria bicolor Protein GET1 (GET1)

Shipped with Ice Packs
In Stock

Description

Introduction

Ectomycorrhizal (ECM) symbiosis, a dominant form of plant-microbe interaction in boreal and temperate forests, significantly contributes to plant health through mineral nutrient cycling . During the establishment of symbiosis, ECM fungi create a sheath around lateral root tips and colonize the apoplastic space between epidermal and cortical root cells, forming the Hartig net .

Laccaria bicolor and Ectomycorrhizal Symbiosis

Laccaria bicolor, an ectomycorrhizal basidiomycete, establishes symbiotic relationships with tree roots, facilitating nutrient exchange . This process requires modifications to the root cell walls to accommodate fungal hyphae within the Hartig net . The fungus secretes proteins to set up the symbiosis by suppressing host immunity and/or targeting cell-wall remodeling .

Pectin Methylesterases (PMEs) in Laccaria bicolor

Pectin methylesterases (PMEs) play a crucial role in modifying pectin within the cell walls during ECM formation . Pectin-mediated adhesion between adjacent root cells loosens to accommodate fungal hyphae in the Hartig net .

LbPME1's Role in ECM Formation

Immunolocalization has identified the remodeling of pectin towards de-esterified homogalacturonan (HG) during ECM formation, accompanied by increased LbPME1 expression and PME activity . Altering LbPME1 transcript levels in L. bicolor through RNA interference (RNAi) or overexpression constructs impacts ECM formation .

  • Hartig Nets formed with LbPME1 RNAi lines were shallower .

  • Hartig Nets formed with LbPME1 overexpressors were deeper .

This suggests that LbPME1 plays a role in ECM formation potentially through HG de-esterification, which initiates the loosening of adjacent root cells to facilitate Hartig net formation .

Functional Analysis of Transgenic L. bicolor Lines

Studies using transgenic L. bicolor lines with modified LbPME1 expression levels provide insights into the role of LbPME1 in ECM development .

  • In LbPME1-4_double RNAi lines, the levels of all four LbPMEs were significantly reduced by 60% compared with levels in wild-type FLM .

  • In single RNAi lines, specifically LbPME1 expression but not LbPME2-4 was reduced to a similar extent, as in the double_RNAi lines .

  • In LbPME1 overexpressor lines, LbPME1 transcript levels were increased by 4.9–7.9‐fold compared with wild‐type FLM, whilst no effect was observed on transcript levels of the other LbPMEs .

Expression levels of ECM-induced LbPGs were examined, revealing a significant reduction of LbPG transcript levels in co-cultures with RNAi and OE lines compared with co-cultures with control L. bicolor lines . This suggests that PG-mediated HG depolymerization may be reduced in co-cultures with RNAi and OE lines .

Glycoside Hydrolase Family 5 (GH5) Endoglucanase, LbGH5-CBM1

The sole cellulose-binding module (CBM1) encoded in the genome of Laccaria bicolor is linked to a glycoside hydrolase family 5 (GH5) endoglucanase, LbGH5-CBM1 . LbGH5-CBM1 expression is substantially induced in ectomycorrhiza, and RNAi mutants with a decreased LbGH5-CBM1 expression have a lower ability to form ectomycorrhiza, suggesting a key role in symbiosis .

Recombinant LbGH5-CBM1 displays its highest activity towards cellulose and galactomannans, but no activity toward L. bicolor cell walls . In situ localization of LbGH5-CBM1 in ectomycorrhiza reveals that the endoglucanase accumulates at the periphery of hyphae forming the Hartig net and the mantle .

MiSSPs (Mycorrhiza-Induced Small Secreted Proteins)

Genome-wide analysis of Laccaria bicolor led to the identification of 98 proteins, named MiSSPs, up-regulated in symbiotic tissues . These proteins play a role in suppressing host immunity and/or targeting cell-wall remodeling .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
GET1; LACBIDRAFT_246680; Protein GET1; Guided entry of tail-anchored proteins 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-187
Protein Length
full length protein
Species
Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) (Bicoloured deceiver) (Laccaria laccata var. bicolor)
Target Names
GET1
Target Protein Sequence
MSLLITIFLLVFITQLVSWIGQTVLLELAYALYLRLTRSAAFARQQALKSEILATKSELL KTSAQDQFAKWAKLRRSVDKGLADLEKLNSQIASSKSSFSLKFNSAIWILTTGVQFVVGW WYRRQPVFYLPEGWFGPLAWWLAFPFAPAGSVSVGVWQMACKRVVVLGERVVKDLTGESL DYVHVSS
Uniprot No.

Target Background

Function
Essential for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum. Functions as a membrane receptor for soluble GET3, which specifically recognizes and binds the transmembrane domain of TA proteins within the cytosol.
Database Links
Protein Families
WRB/GET1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Laccaria bicolor GET1 protein and what is its confirmed function?

Laccaria bicolor GET1 (Guided entry of tail-anchored proteins 1) is a 187-amino acid protein (UniProt ID: B0D1L7) encoded in the genome of the ectomycorrhizal basidiomycete fungus L. bicolor . The protein is part of the GET pathway that mediates the insertion of tail-anchored proteins into membranes. While the specific functions in L. bicolor are still being investigated, GET pathway proteins generally facilitate proper targeting and membrane integration of tail-anchored proteins, which are critical for various cellular processes including vesicular transport, protein translocation, and membrane dynamics .

To study GET1 function in L. bicolor, researchers typically use molecular techniques including:

  • Gene expression analysis during different developmental stages

  • Protein localization studies using fluorescent protein fusions

  • Functional characterization through RNAi-based gene silencing (similar to the approach used for other L. bicolor proteins like MiSSP8)

How is recombinant L. bicolor GET1 typically expressed and purified?

Based on established protocols for L. bicolor recombinant proteins, GET1 is typically:

Expression System:

  • Expressed in E. coli as the preferred heterologous system

  • Commonly fused with an N-terminal His-tag for purification purposes

  • Expression vectors contain either full-length (1-187 aa) or partial constructs depending on research goals

Expression Protocol:

  • Transform competent E. coli cells with expression vector containing the GET1 gene

  • Culture in media containing appropriate antibiotics (typically kanamycin at 30 μg/ml and chloramphenicol at 34 μg/ml)

  • Induce expression when culture reaches OD600 of 0.7 with IPTG (0.1 mM)

  • Continue growth for 4 hours at 37°C

  • Harvest cells by centrifugation and lyse in appropriate buffer (typically Tris/HCl pH 8.0 with 200 mM NaCl)

Purification Method:

  • Affinity chromatography using Ni-NTA resin to capture His-tagged protein

  • Quality control via SDS-PAGE to verify purity (target >85-90%)

  • Further purification via size exclusion chromatography if needed

What are the optimal storage conditions for recombinant L. bicolor GET1 protein?

Based on established protocols for recombinant L. bicolor proteins, the following storage guidelines are recommended:

Storage Recommendations:

  • Short-term (up to one week): Store working aliquots at 4°C

  • Long-term storage: Store at -20°C/-80°C

  • Lyophilized form: Stable for up to 12 months at -20°C/-80°C

  • Liquid form: Stable for approximately 6 months at -20°C/-80°C

Reconstitution Protocol:

  • Centrifuge vial briefly before opening to bring contents to bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (standard protocol uses 50%)

  • Create small working aliquots to avoid repeated freeze-thaw cycles

Buffer Composition:

  • Typical storage buffer: Tris/PBS-based buffer with 6% Trehalose, pH 8.0

How can researchers effectively use GET1 in immunolocalization studies?

While the search results don't provide specific protocols for GET1 immunolocalization, techniques similar to those used for other L. bicolor proteins can be applied:

Immunolocalization Protocol:

  • Generate specific antibodies against recombinant GET1 or use anti-His antibodies if working with tagged protein

  • For in planta studies, establish mycorrhizal association between L. bicolor and host plant (typically Populus species)

  • Fix and section the tissue samples using standard protocols

  • Perform immunolocalization using either:

    • Immunofluorescence confocal microscopy (similar to techniques used for LbGH5-CBM1)

    • Immunogold cytochemical microscopy (similar to techniques used for LbGH28A)

  • Include appropriate controls (pre-immune serum, non-mycorrhizal tissues)

This approach would help determine the subcellular localization of GET1 during symbiotic interaction, offering insights into its functional role during mycorrhiza formation.

What methods are recommended for studying GET1 expression patterns during symbiosis?

Based on methodologies used for other L. bicolor proteins, researchers can employ:

Gene Expression Analysis:

  • Establish mycorrhizal cultures with different developmental stages (free-living mycelium, early contact, mature ectomycorrhiza)

  • Extract RNA from different developmental stages

  • Perform RT-qPCR using GET1-specific primers

    • Use appropriate reference genes for normalization

    • Follow protocols similar to those used for LbGH5-CBM1 or MiSSP8

  • For broader transcriptomic analysis, RNA-seq can be performed to analyze GET1 expression in context with other symbiosis-related genes

Protein Expression:

  • Generate protein extracts from different developmental stages

  • Perform Western blotting using anti-GET1 antibodies

  • Quantify relative protein abundance across stages

This combined approach would provide insights into transcriptional regulation and protein accumulation patterns during symbiotic development.

How can RNAi techniques be optimized to study GET1 function in L. bicolor?

Based on successful RNAi approaches used for other L. bicolor proteins, researchers can employ:

RNAi Silencing Protocol:

  • Design RNAi constructs targeting GET1:

    • Create hairpin structures targeting unique regions of GET1 mRNA

    • Clone into appropriate vectors like pSILBAy

    • Transfer to binary vectors (e.g., pHg) for Agrobacterium-mediated transformation

  • Transform L. bicolor:

    • Use Agrobacterium tumefaciens strain AGL1 for transformation

    • Select transformants on media containing hygromycin B (initially 300 μg/mL, maintain at 150 μg/mL)

  • Validate knockdown efficiency:

    • Perform qPCR to quantify GET1 transcript reduction

    • Confirm protein reduction via Western blotting

  • Phenotypic analysis:

    • Assess growth morphology in pure culture

    • Evaluate mycorrhization capacity with host trees (typically Populus species)

    • Quantify mycorrhization rate and Hartig net development

This approach has been successfully used for studying other symbiosis proteins in L. bicolor, such as MiSSP8, where RNAi mutants showed reduced mycorrhization capacity .

How does GET1 potentially interact with other known symbiosis effectors in L. bicolor?

While direct interactions between GET1 and other symbiosis proteins haven't been specifically documented in the search results, researchers can explore potential interactions using:

Protein-Protein Interaction Analysis:

  • Yeast two-hybrid (Y2H) screening:

    • Use GET1 as bait to screen for interacting partners

    • Perform targeted Y2H with known symbiosis effectors (MiSSP7, MiSSP8)

    • Validate interactions with complementary approaches

  • Co-immunoprecipitation:

    • Express tagged versions of GET1 and potential interacting partners

    • Perform pull-down assays followed by mass spectrometry

    • Validate interactions in planta during symbiosis

  • Bimolecular Fluorescence Complementation (BiFC):

    • Generate fusion constructs of GET1 and potential interacting partners with split fluorescent protein fragments

    • Express in appropriate cell types and observe reconstitution of fluorescence

Understanding these interactions could reveal whether GET1 functions in known symbiosis pathways or represents a novel mechanism in ectomycorrhizal development.

What role might GET1 play in relation to cell wall modification enzymes during ectomycorrhiza formation?

L. bicolor secretes several enzymes involved in cell wall modification during symbiosis, including LbGH5-CBM1 (endoglucanase) and LbGH28A (polygalacturonase) . The potential relationship between GET1 and these enzymes could be investigated through:

Functional Relationship Analysis:

  • Comparative expression profiling:

    • Analyze GET1 expression patterns in relation to known cell wall-modifying enzymes

    • Look for co-regulation patterns suggesting functional relationships

  • Localization studies:

    • Perform co-localization experiments with GET1 and cell wall-modifying enzymes

    • Determine if GET1 localizes to sites of active cell wall remodeling during Hartig net formation

  • GET1 knockdown impact:

    • In GET1 RNAi mutants, assess expression and activity of cell wall-modifying enzymes

    • Evaluate if reduced GET1 expression affects secretion or localization of these enzymes

GET1, as a protein potentially involved in membrane protein targeting, might play a role in the proper secretion or membrane localization of symbiosis-related enzymes and effectors that are critical for ectomycorrhiza formation.

What fluorescent protein tagging strategies are most effective for studying GET1 in L. bicolor?

Based on successful approaches with other L. bicolor proteins:

Fluorescent Tagging Strategies:

  • Selection of fluorescent proteins:

    • eGFP and mCherry have been successfully used in L. bicolor

    • Intron-containing constructs are essential for efficient expression in L. bicolor

  • Optimal construct design:

    • For nuclear localization: In-frame fusion between intron-containing histone H2B sequences

    • For cytosolic expression: Incorporate intron-containing 5' fragment of glyceraldehyde-3-phosphate dehydrogenase

    • Include the Laccaria Kozak consensus sequence to boost transgene expression

  • Expression systems:

    • Use either endogenous GET1 promoter to maintain native regulation

    • Or constitutive Agaricus bisporus gpdII promoter for enhanced visualization

  • Transformation and selection:

    • Agrobacterium-mediated transformation is most effective

    • Select transformants using appropriate antibiotics

    • Verify expression and localization using confocal microscopy

These approaches would allow live-cell imaging of GET1 during symbiotic development and provide insights into its dynamic localization and potential interactions.

What are the most important quality control steps when working with recombinant L. bicolor GET1?

To ensure reliable experimental results:

Quality Control Protocol:

  • Purity assessment:

    • SDS-PAGE analysis (target >85-90% purity)

    • Mass spectrometry to confirm protein identity

    • Western blotting with anti-His or specific GET1 antibodies

  • Functional verification:

    • Assess proper folding using circular dichroism

    • If functional assays exist, confirm activity of purified protein

    • For transmembrane proteins like GET1, evaluate membrane integration capacity

  • Storage stability monitoring:

    • Analyze protein integrity after different storage periods

    • Check for degradation via SDS-PAGE

    • Avoid repeated freeze-thaw cycles that can compromise protein quality

  • Batch consistency verification:

    • Maintain detailed records of expression and purification conditions

    • Compare batch-to-batch variation to ensure experimental reproducibility

Implementing these quality control measures ensures that experimental outcomes reflect true biological functions rather than artifacts from compromised protein samples.

Table 1: Comparison of Key Symbiosis-Related Proteins in Laccaria bicolor

ProteinSize (aa)FunctionExpression PatternLocalizationEffect of RNAi KnockdownReference
GET1187Guided entry of tail-anchored proteinsNot specified in search resultsNot specified in search resultsNot specified in search results
LbGH5-CBM1VariableCell wall remodeling (endoglucanase)Induced during ectomycorrhizaPeriphery of Hartig net hyphaeReduced mycorrhization capacity
LbGH28AVariableCell wall remodeling (polygalacturonase)Induced during ectomycorrhizaFungal and plant cell walls at symbiotic frontReduced mycorrhization capacity
MiSSP7VariableJA signaling modulationInduced during symbiosisInteracts with PtJAZ6 in hostAltered symbiotic development
MiSSP8VariableSymbiosis establishmentInduced during symbiosisNot specified in search results70-75% reduction in mycorrhization

Table 2: Recommended Expression and Purification Conditions for Recombinant L. bicolor GET1

ParameterRecommended ConditionNotes
Expression SystemE. coliPreferred heterologous system
Vector TagN-terminal His-tagFacilitates purification via Ni-NTA
Culture MediumLB with kanamycin (30 μg/ml) and chloramphenicol (34 μg/ml)Based on protocols for similar L. bicolor proteins
Induction0.1 mM IPTG at OD600 = 0.7Standard protocol for L. bicolor proteins
Expression Temperature37°C for 4 hours post-inductionOptimized for soluble protein production
Lysis BufferTris/HCl pH 8.0 with 200 mM NaClStandard for L. bicolor recombinant proteins
Purification MethodNi-NTA affinity chromatographyFor His-tagged constructs
Quality Control Standard>85-90% purity by SDS-PAGERecommended minimum purity
Storage BufferTris/PBS-based with 6% Trehalose, pH 8.0Maintains protein stability
Storage Temperature-20°C/-80°C (long-term); 4°C (up to 1 week)Avoid repeated freeze-thaw cycles

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.